2025-07-09 15:29:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001331584 657 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana Rab GTPase-like A5A protein (RABA5E), partial mRNA. ACCESSION NM_001331584 VERSION NM_001331584.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 657) AUTHORS Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S., White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L., Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F., Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R., Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J., Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B., Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J., Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L., Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S., Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X., Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J., Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G., Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H., Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H., Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T., Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G., Fraser,C.M., Venter,J.C. and Davis,R.W. TITLE Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 816-820 (2000) PUBMED 11130712 REFERENCE 2 (bases 1 to 657) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 657) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 657) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 5 (bases 1 to 657) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003070). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..657 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene <1..>657 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /db_xref="Araport:AT1G05810" /db_xref="GeneID:837091" /db_xref="TAIR:AT1G05810" CDS 1..657 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /inference="Similar to RNA sequence, EST:INSD:CK119916.1,INSD:EH980842.1,INSD:AV789625.1, INSD:BP575803.1,INSD:CB261341.1,INSD:BP596412.1, INSD:DR287737.1,INSD:AV825056.1,INSD:BP615697.1, INSD:BP611642.1,INSD:EH800885.1,INSD:BP781765.1, INSD:EH865612.1" /inference="similar to RNA sequence, mRNA:INSD:BT006190.1,INSD:AY063847.1,INSD:AF332457.1" /note="RAB GTPase homolog A5E (RABA5E); FUNCTIONS IN: GTP binding; INVOLVED IN: protein transport, small GTPase mediated signal transduction; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Ras GTPase (InterPro:IPR001806), Small GTP-binding protein (InterPro:IPR005225), Small GTPase (InterPro:IPR020851), Ras (InterPro:IPR013753), Ras small GTPase, Rab type (InterPro:IPR003579), Rab11-related (InterPro:IPR015595); BEST Arabidopsis thaliana protein match is: RAB GTPase homolog A5D (TAIR:AT2G31680.1); Has 27587 Blast hits to 27548 proteins in 749 species: Archae - 23; Bacteria - 136; Metazoa - 14522; Fungi - 3761; Plants - 3260; Viruses - 20; Other Eukaryotes - 5865 (source: NCBI BLink)." /codon_start=1 /product="Rab GTPase-like A5A protein" /protein_id="NP_001318930.1" /db_xref="Araport:AT1G05810" /db_xref="GeneID:837091" /db_xref="TAIR:AT1G05810" /translation="
MSSDDEGREEYLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLENIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDELTVNRVSLVKDDNSASKQSSGFSCCSST"
misc_feature 28..522 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25; Region: Rab11_like; cd01868" /db_xref="CDD:206660" misc_feature 28..42 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206660" misc_feature 55..78 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="G1 box; other site" /db_xref="CDD:206660" misc_feature order(61..81,112..114,121..123,130..132,208..210,373..378, 382..384,463..471) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206660" misc_feature order(79..114,118..129) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206660" misc_feature order(109..111,124..150) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Switch I region; other site" /db_xref="CDD:206660" misc_feature order(124..126,136..159,178..180,184..186) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206660" misc_feature 130..132 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="G2 box; other site" /db_xref="CDD:206660" misc_feature order(133..135,139..147,190..192,196..198,217..222, 229..231,241..243,247..258,517..519) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="putative effector interaction site [active]" /db_xref="CDD:206660" misc_feature order(133..138,142..144,196..201,220..222,226..228, 232..240) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206660" misc_feature 133..147 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206660" misc_feature 184..198 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206660" misc_feature 199..210 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="G3 box; other site" /db_xref="CDD:206660" misc_feature order(208..210,214..246) /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Switch II region; other site" /db_xref="CDD:206660" misc_feature 217..234 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206660" misc_feature 241..255 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206660" misc_feature 268..285 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206660" misc_feature 352..366 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206660" misc_feature 373..384 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="G4 box; other site" /db_xref="CDD:206660" misc_feature 463..471 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="G5 box; other site" /db_xref="CDD:206660" misc_feature 511..522 /gene="RABA5E" /locus_tag="AT1G05810" /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E; T20M3.8; T20M3_8" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:206660" ORIGIN
atgtcttcggacgacgaaggaagagaggagtatctcttcaagattgttgttatcggcgactctgccgtcggtaaatctaatcttctatctcgttacgcacgtaacgagttcagcgctaactccaaggcgacgatcggagtcgagtttcagacgcagagcatggagattgaaggtaaagaggtcaaggctcagatttgggacactgctggtcaggagcgtttccgtgccgtcacttccgcttattaccgtggcgctgtcggtgccctcgtcgtttacgacattacccgccgcaccactttcgaaagcgttggacgttggctcgatgagcttaagatccattcggatacgacggtggcgagaatgctggtggggaacaagtgtgatctagaaaacataagagcagtgagcgtggaggaaggaaaggctctagccgaagaggaaggactcttctttgtggaaacatcggctcttgattcgactaatgttaaaacagctttcgagatggtgatacttgatatctacaataacgtgagccgtaagcaactcaactcagatacttataaagacgaactcaccgtgaatcgggtaagtcttgttaaggatgataactctgcctccaaacaaagctctggtttctcttgttgttcttccacttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]