GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-01 08:10:57, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001124873             575 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana transcription factor/transcription regulator
            (AT2G18969), partial mRNA.
ACCESSION   NM_001124873
VERSION     NM_001124873.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 575)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 575)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 575)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 575)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_001124873.1.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..575
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            <1..575
                     /locus_tag="AT2G18969"
                     /note="Encodes a atypical member of the bHLH (basic
                     helix-loop-helix) family transcriptional factors."
                     /db_xref="Araport:AT2G18969"
                     /db_xref="GeneID:6240648"
                     /db_xref="TAIR:AT2G18969"
     CDS             1..528
                     /locus_tag="AT2G18969"
                     /inference="Similar to RNA sequence,
                     EST:INSD:T76845.1,INSD:N37609.1"
                     /note="BEST Arabidopsis thaliana protein match is:
                     sequence-specific DNA binding transcription
                     factors;transcription regulators (TAIR:AT4G30180.1); Has
                     30201 Blast hits to 17322 proteins in 780 species: Archae
                     - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422;
                     Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="transcription factor/transcription regulator"
                     /protein_id="NP_001118345.1"
                     /db_xref="Araport:AT2G18969"
                     /db_xref="GeneID:6240648"
                     /db_xref="TAIR:AT2G18969"
                     /translation="
MERQIINKRKRVFSLQPNKNPKAVFARRYVSHLVPALKKINMNKSSSKTNKQSLEQTVKHEVDMAFALSAQEFAWSRFLQQKLLSSPYDDPISTSSSPSEILERSSKRQGGEKHQDSDEEEEGGEIKKRLKELQKLLPGGEEMNMEEILSEIGSYIVCLELQMIVLKSIVQDNTS"
     misc_feature    376..510
                     /locus_tag="AT2G18969"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     Arabidopsis thaliana ILI1-BINDING BHLH 1 (IBH1) and
                     similar proteins; Region: bHLH_AtIBH1_like; cd11444"
                     /db_xref="CDD:381450"
     misc_feature    order(376..378,385..387,394..399,406..408,433..438,
                     445..450,457..459,466..468,475..480,487..489,496..501,
                     505..510)
                     /locus_tag="AT2G18969"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381450"
ORIGIN      
atggagaggcaaattataaacaagagaaagcgagtcttttctctccaaccaaacaagaaccctaaggcagttttcgcaagaagatacgtgagtcacttggttccagctcttaaaaagatcaacatgaacaaatcctcttcaaaaaccaacaaacaaagtttagaacaaaccgtgaaacatgaagtagacatggctttcgcattgtctgctcaagaattcgcgtggagccgtttcttgcaacagaagctattatcttccccttatgatgatccaattagcactagtagttctccttccgagattctagaaagatcgagcaagagacaaggtggagaaaaacaccaagacagcgacgaagaagaagaaggaggagagatcaagaagagattgaaggaattgcagaagcttttgccaggtggagaagagatgaacatggaggagattttgagtgagattggaagctacattgtatgtcttgaattgcagatgattgttttaaaatctattgtacaagataatacttcttgaatataatataattcattgtttcttctcttcaatatgataaggcgaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]