2025-09-18 13:22:08, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_070189678 570 bp mRNA linear PLN 05-DEC-2024 DEFINITION PREDICTED: Nicotiana tomentosiformis uncharacterized protein (LOC138901881), mRNA. ACCESSION XM_070189678 VERSION XM_070189678.1 DBLINK BioProject: PRJNA257218 KEYWORDS RefSeq; includes ab initio. SOURCE Nicotiana tomentosiformis ORGANISM Nicotiana tomentosiformis Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_090822) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000390325.3-RS_2024_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/03/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..570 /organism="Nicotiana tomentosiformis" /mol_type="mRNA" /bio_material="USDA:TW 142" /db_xref="taxon:4098" /chromosome="11" /tissue_type="leaf" gene 1..570 /gene="LOC138901881" /note="uncharacterized LOC138901881; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:138901881" CDS 1..570 /gene="LOC138901881" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070045779.1" /db_xref="GeneID:138901881" /translation="
MSDEEQKRLEWFRRLNPPSFSGFELEDVQNFLDRCQQILRTAGILETSGWEAYELSSPVGAAPLTWHDFSNLFLEKFAPSTRKKELCRQFEQLCQEGVSMTQYEMRFSKLAYHTISLVPTERDSIRRFIDVHNYGLRFVMTREIASGARFDEVVDIAKRLEQVRSQECEERKEKRPPGLGSFSGVSFGG"
misc_feature 148..411 /gene="LOC138901881" /note="Retrotransposon gag protein; Region: Retrotrans_gag; cl46289" /db_xref="CDD:480629" ORIGIN
atgagtgatgaggaacagaagaggctagagtggtttaggaggctcaatcctccatcattcagtgggtttgagttagaggatgttcagaacttcttggataggtgccagcagattcttcgcacggcgggtattctggagactagtggatgggaggcctatgagttgagtagtccagtcggcgctgcaccacttacatggcacgacttctccaatctcttcttggagaagtttgcaccatcaacacgcaagaaggagttgtgtaggcagtttgagcagctatgccaggagggtgtgtccatgactcagtacgagatgagattttcaaaattggcttatcacacaatctcgttggttcccacagagagggatagtattaggaggttcattgatgtccataattatggactgcgatttgtcatgactcgggagattgcatcaggtgctaggttcgatgaggtggttgacattgctaagcgactagagcaggtccgtagtcaggagtgtgaggagaggaaggaaaagaggcctcctggtttgggtagtttcagcggtgtttcttttggagggtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]