LOCUS       XM_070189678             570 bp    mRNA    linear   PLN 05-DEC-2024
DEFINITION  PREDICTED: Nicotiana tomentosiformis uncharacterized protein
            (LOC138901881), mRNA.
ACCESSION   XM_070189678
VERSION     XM_070189678.1
DBLINK      BioProject: PRJNA257218
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Nicotiana tomentosiformis
  ORGANISM  Nicotiana tomentosiformis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Nicotianoideae; Nicotianeae; Nicotiana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_090822) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000390325.3-RS_2024_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/03/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..570
                     /organism="Nicotiana tomentosiformis"
                     /mol_type="mRNA"
                     /bio_material="USDA:TW 142"
                     /db_xref="taxon:4098"
                     /chromosome="11"
                     /tissue_type="leaf"
     gene            1..570
                     /gene="LOC138901881"
                     /note="uncharacterized LOC138901881; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:138901881"
     CDS             1..570
                     /gene="LOC138901881"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_070045779.1"
                     /db_xref="GeneID:138901881"
                     /translation="

MSDEEQKRLEWFRRLNPPSFSGFELEDVQNFLDRCQQILRTAGILETSGWEAYELSSPVGAAPLTWHDFSNLFLEKFAPSTRKKELCRQFEQLCQEGVSMTQYEMRFSKLAYHTISLVPTERDSIRRFIDVHNYGLRFVMTREIASGARFDEVVDIAKRLEQVRSQECEERKEKRPPGLGSFSGVSFGG"

     misc_feature    148..411
                     /gene="LOC138901881"
                     /note="Retrotransposon gag protein; Region:
                     Retrotrans_gag; cl46289"
                     /db_xref="CDD:480629"
ORIGIN      

atgagtgatgaggaacagaagaggctagagtggtttaggaggctcaatcctccatcattcagtgggtttgagttagaggatgttcagaacttcttggataggtgccagcagattcttcgcacggcgggtattctggagactagtggatgggaggcctatgagttgagtagtccagtcggcgctgcaccacttacatggcacgacttctccaatctcttcttggagaagtttgcaccatcaacacgcaagaaggagttgtgtaggcagtttgagcagctatgccaggagggtgtgtccatgactcagtacgagatgagattttcaaaattggcttatcacacaatctcgttggttcccacagagagggatagtattaggaggttcattgatgtccataattatggactgcgatttgtcatgactcgggagattgcatcaggtgctaggttcgatgaggtggttgacattgctaagcgactagagcaggtccgtagtcaggagtgtgaggagaggaaggaaaagaggcctcctggtttgggtagtttcagcggtgtttcttttggagggtag

//