GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-02-24 05:44:17, GGRNA.v2 : RefSeq release 228 (Jan, 2025)

LOCUS       XM_068326414            1430 bp    mRNA    linear   VRT 14-SEP-2024
DEFINITION  PREDICTED: Antennarius striatus vimentin-related 2 (vimr2), mRNA.
ACCESSION   XM_068326414
VERSION     XM_068326414.1
DBLINK      BioProject: PRJNA1159349
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Antennarius striatus (striated frogfish)
  ORGANISM  Antennarius striatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Lophiiformes; Antennarioidei;
            Antennariidae; Antennarius.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_090785) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_040054535.1-RS_2024_09
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 09/13/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1430
                     /organism="Antennarius striatus"
                     /mol_type="mRNA"
                     /isolate="MH-2024"
                     /db_xref="taxon:241820"
                     /chromosome="10"
                     /sex="female"
                     /tissue_type="kidney"
                     /dev_stage="adult"
     gene            1..1430
                     /gene="vimr2"
                     /note="vimentin-related 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:137603174"
     CDS             130..1266
                     /gene="vimr2"
                     /codon_start=1
                     /product="vimentin"
                     /protein_id="XP_068182515.1"
                     /db_xref="GeneID:137603174"
                     /translation="
MAVIRVSSYRKLFEDDHWRGNVGLSARCAGQYQASIRAADKRYCENLDFATAKKLNIEGLNCFLQDRIVITSLNDRLVRLIELARCFEEENESLECQIDDLEEKLYRRKASFSNTSAAAEPESGLDAVVENLRRERDEILNDTEELRKELECLMKHCENATHRRTLLQREQQNVAEAVDGVTAGCLALREQVSIYEKQLDNMEAQKALESLLEPVEGITGALAAIKYGSPDIAPALDVKEFYCQLAERLKFDCGATSSAVVCNGYRKQLDKEGAVKSKDISEMKMMTYKLQKKLAVLEKYNNELEEEFSMRNAAYADEIAELESTIDEMQHQEAKLKVQMKEQCEDYKELLSEKMARDMEIAAYRSLVEEEEERLSKM"
ORIGIN      
agtctgttcagtggtcagtgggggattcctcacttcagtgctacattctgattatctgtgaatataaactcccccactttggacctgttaccaacatttgcctgttgtggtgcagcctagtttgaagccatggccgttatcagggtgtcttcttaccgcaagctgttcgaggatgatcactggagaggaaatgtagggttgagtgcgaggtgtgccgggcagtaccaggcctccatcagagctgcggacaagcgttactgtgagaatttagactttgccactgcaaagaagctcaacatagagggtctgaattgttttcttcaggaccgcattgtcatcaccagcctcaatgaccgtctggtcaggcttattgaactggcccgttgttttgaagaggagaacgagtctcttgaatgtcagattgatgatctagaggagaagctgtatagacgaaaagcttccttcagcaacacctctgctgcagctgagccggaatccggtctggatgcagtggtggagaacctacgcagggagagggatgagattctgaatgacaccgaagaactgcgtaaggagcttgaatgtttgatgaaacactgtgagaacgctacacatcgtcggaccctcctgcagcgagagcagcaaaatgttgctgaggcagtggacggcgtgacagccgggtgcttggcgttgagggagcaggtgtctatctatgagaagcagctggacaacatggaggcacagaaggcattggagagtctcctggagccagttgaagggattacgggggcgctggcagctattaaatatggcagccctgacatcgctccggctttggatgtaaaggagttctactgccagctggctgagagactgaagtttgactgtggcgcgacgtcttctgctgtggtttgcaacggttacaggaaacaactggacaaggaaggagctgtcaagtcaaaagacatcagtgagatgaagatgatgacctacaagctacaaaagaagcttgctgtgcttgagaagtacaacaatgagctggaggaagagttcagtatgaggaacgctgcatacgcggatgagatcgctgagctggagagtactatagatgaaatgcagcaccaggaggccaaactaaaagtgcagatgaaggagcagtgtgaagattacaaggagctgctcagtgagaagatggccagagatatggaaatagctgcatacaggagtctggtggaggaagaggaagagaggctgtccaaaatgtgacgtgaggccagaaaatctcaataactgtatgctccccctggtacgcattaccaaacaaacaagtcttcttgaagatgcaatgccgtgctgcttggatagtatagctaagtaagctaagcttctagtaactctacagtaaataagtcttcactacactgaagcca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]