LOCUS       XM_065715454             567 bp    mRNA    linear   INV 13-JUN-2024
DEFINITION  PREDICTED: Artemia franciscana craniofacial development protein
            2-like (LOC136034319), mRNA.
ACCESSION   XM_065715454
VERSION     XM_065715454.1
DBLINK      BioProject: PRJNA1119551
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Artemia franciscana
  ORGANISM  Artemia franciscana
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Branchiopoda;
            Anostraca; Artemiidae; Artemia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_088875) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_032884065.1-RS_2024_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Artemia franciscana"
                     /mol_type="mRNA"
                     /db_xref="taxon:6661"
                     /chromosome="13"
                     /sex="female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /geo_loc_name="USA"
                     /collection_date="2019-12-09"
     gene            1..567
                     /gene="LOC136034319"
                     /note="craniofacial development protein 2-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 8 Proteins"
                     /db_xref="GeneID:136034319"
     CDS             1..567
                     /gene="LOC136034319"
                     /codon_start=1
                     /product="craniofacial development protein 2-like"
                     /protein_id="XP_065571526.1"
                     /db_xref="GeneID:136034319"
                     /translation="

MNRYHWDIVGLSETHLPFTGIERINDIKLITSRRSDGVHRQGVGFLLYKRAKQSLLAVHPVSDRIITIRLKGTIANMTIIHVYAPDSSRNDQEAEEFYSQLQYTVDTAPKRDVLFVIGDFNAIVGLSNDRLEDVMGKFGHGWQNHRGEMLINLCRDNELFITNTMFRHRERRKVTWRSPDGRTANMID"

ORIGIN      

atgaaccgttaccactgggacatcgttggactttctgagactcaccttcccttcacaggaatagaaagaataaacgacataaagctcatcacgtctcgaagaagtgatggagttcaccgccaaggtgtcggtttcctactctacaagcgagccaaacaatctcttcttgccgtccatcctgtctctgaccgtattatcaccattcgtctaaaaggaaccattgccaatatgaccataattcacgtttacgccccagactcgtcccggaatgaccaagaagccgaagaattctacagccaactccaatacaccgttgacacggctcccaagagagatgttctgttcgtgattggggacttcaacgccattgtcggactctcaaatgatagacttgaagatgtcatgggcaagttcgggcacgggtggcagaaccacaggggtgaaatgctcatcaacttgtgtcgggataacgaacttttcataacgaacaccatgttccgtcatagagaacgaaggaaagttacttggagatcccctgacggccgcactgcaaacatgattgattaa

//