2025-03-11 02:31:58, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_065715454 567 bp mRNA linear INV 13-JUN-2024 DEFINITION PREDICTED: Artemia franciscana craniofacial development protein 2-like (LOC136034319), mRNA. ACCESSION XM_065715454 VERSION XM_065715454.1 DBLINK BioProject: PRJNA1119551 KEYWORDS RefSeq; includes ab initio. SOURCE Artemia franciscana ORGANISM Artemia franciscana Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea; Branchiopoda; Anostraca; Artemiidae; Artemia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_088875) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_032884065.1-RS_2024_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..567 /organism="Artemia franciscana" /mol_type="mRNA" /db_xref="taxon:6661" /chromosome="13" /sex="female" /tissue_type="whole body" /dev_stage="adult" /geo_loc_name="USA" /collection_date="2019-12-09" gene 1..567 /gene="LOC136034319" /note="craniofacial development protein 2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:136034319" CDS 1..567 /gene="LOC136034319" /codon_start=1 /product="craniofacial development protein 2-like" /protein_id="XP_065571526.1" /db_xref="GeneID:136034319" /translation="
MNRYHWDIVGLSETHLPFTGIERINDIKLITSRRSDGVHRQGVGFLLYKRAKQSLLAVHPVSDRIITIRLKGTIANMTIIHVYAPDSSRNDQEAEEFYSQLQYTVDTAPKRDVLFVIGDFNAIVGLSNDRLEDVMGKFGHGWQNHRGEMLINLCRDNELFITNTMFRHRERRKVTWRSPDGRTANMID"
ORIGIN
atgaaccgttaccactgggacatcgttggactttctgagactcaccttcccttcacaggaatagaaagaataaacgacataaagctcatcacgtctcgaagaagtgatggagttcaccgccaaggtgtcggtttcctactctacaagcgagccaaacaatctcttcttgccgtccatcctgtctctgaccgtattatcaccattcgtctaaaaggaaccattgccaatatgaccataattcacgtttacgccccagactcgtcccggaatgaccaagaagccgaagaattctacagccaactccaatacaccgttgacacggctcccaagagagatgttctgttcgtgattggggacttcaacgccattgtcggactctcaaatgatagacttgaagatgtcatgggcaagttcgggcacgggtggcagaaccacaggggtgaaatgctcatcaacttgtgtcgggataacgaacttttcataacgaacaccatgttccgtcatagagaacgaaggaaagttacttggagatcccctgacggccgcactgcaaacatgattgattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]