2024-04-20 10:51:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_041676515 654 bp mRNA linear ROD 14-MAY-2021 DEFINITION PREDICTED: Microtus oregoni claudin 9 (Cldn9), mRNA. ACCESSION XM_041676515 VERSION XM_041676515.1 DBLINK BioProject: PRJNA729470 KEYWORDS RefSeq. SOURCE Microtus oregoni (creeping vole) ORGANISM Microtus oregoni Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Arvicolinae; Microtus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024543086.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Microtus oregoni Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..654 /organism="Microtus oregoni" /mol_type="mRNA" /isolate="MIOR12" /isolation_source="kidney" /db_xref="taxon:111838" /chromosome="Unknown" /country="USA: Oregon" /lat_lon="45.06 N 124.0 W" /collection_date="2018-08" gene 1..654 /gene="Cldn9" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 28 Proteins" /db_xref="GeneID:121463937" CDS 1..654 /gene="Cldn9" /codon_start=1 /product="claudin-9" /protein_id="XP_041532449.1" /db_xref="GeneID:121463937" /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
misc_feature 10..489 /gene="Cldn9" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atggcttcaactggtcttgaactcctgggcatgaccctggcagtgctaggctggctagggaccctggtgtcctgtgccctaccactgtggaaggtgactgccttcatcggcaacagcatcgttgtggcccaggtggtgtgggaggggctgtggatgtcctgtgtggtccagagcactggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgttgttgccctcctgctggctttgctgggcctgctggtggccatcacgggtgcccagtgcaccacatgcgtggaggacgaaggtgccaaggcccgaattgtgctcaccgcaggggtcctccttctcctctcgggcatcctggtgctcatccctgtctgctggacagcccatgccatcatccaggatttctataacccactggtggctgaagccctcaagagagagttgggggcctccctctacctgggctgggcagcggcggcactgctcatgctgggtggagggctcctctgctgcacgtgtcccccgtcccatttcgagcggccccgtggacccaggctgggctactccatcccctcccgttcgggtgcttcaggactggataagagggactatgtgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]