GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 10:51:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_041676515             654 bp    mRNA    linear   ROD 14-MAY-2021
DEFINITION  PREDICTED: Microtus oregoni claudin 9 (Cldn9), mRNA.
ACCESSION   XM_041676515
VERSION     XM_041676515.1
DBLINK      BioProject: PRJNA729470
KEYWORDS    RefSeq.
SOURCE      Microtus oregoni (creeping vole)
  ORGANISM  Microtus oregoni
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Cricetidae; Arvicolinae; Microtus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024543086.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Microtus oregoni Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Microtus oregoni"
                     /mol_type="mRNA"
                     /isolate="MIOR12"
                     /isolation_source="kidney"
                     /db_xref="taxon:111838"
                     /chromosome="Unknown"
                     /country="USA: Oregon"
                     /lat_lon="45.06 N 124.0 W"
                     /collection_date="2018-08"
     gene            1..654
                     /gene="Cldn9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 28 Proteins"
                     /db_xref="GeneID:121463937"
     CDS             1..654
                     /gene="Cldn9"
                     /codon_start=1
                     /product="claudin-9"
                     /protein_id="XP_041532449.1"
                     /db_xref="GeneID:121463937"
                     /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
     misc_feature    10..489
                     /gene="Cldn9"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
atggcttcaactggtcttgaactcctgggcatgaccctggcagtgctaggctggctagggaccctggtgtcctgtgccctaccactgtggaaggtgactgccttcatcggcaacagcatcgttgtggcccaggtggtgtgggaggggctgtggatgtcctgtgtggtccagagcactggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgttgttgccctcctgctggctttgctgggcctgctggtggccatcacgggtgcccagtgcaccacatgcgtggaggacgaaggtgccaaggcccgaattgtgctcaccgcaggggtcctccttctcctctcgggcatcctggtgctcatccctgtctgctggacagcccatgccatcatccaggatttctataacccactggtggctgaagccctcaagagagagttgggggcctccctctacctgggctgggcagcggcggcactgctcatgctgggtggagggctcctctgctgcacgtgtcccccgtcccatttcgagcggccccgtggacccaggctgggctactccatcccctcccgttcgggtgcttcaggactggataagagggactatgtgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]