LOCUS       XM_041523845             741 bp    mRNA    linear   INV 09-MAY-2021
DEFINITION  PREDICTED: Gigantopelta aegis zinc finger and SCAN
            domain-containing protein 26-like (LOC121392757), transcript
            variant X1, mRNA.
ACCESSION   XM_041523845
VERSION     XM_041523845.1
DBLINK      BioProject: PRJNA727593
KEYWORDS    RefSeq.
SOURCE      Gigantopelta aegis
  ORGANISM  Gigantopelta aegis
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda;
            Neomphalina; Neomphaloidea; Peltospiridae; Gigantopelta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024533861.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gigantopelta aegis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..741
                     /organism="Gigantopelta aegis"
                     /mol_type="mRNA"
                     /isolate="Gae_Host"
                     /isolation_source="hydrothermal vent"
                     /db_xref="taxon:1735272"
                     /chromosome="Unknown"
                     /tissue_type="foot"
                     /country="Indian Ocean"
                     /collection_date="2019-04"
     gene            1..741
                     /gene="LOC121392757"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 3 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:121392757"
     CDS             189..608
                     /gene="LOC121392757"
                     /codon_start=1
                     /product="zinc finger and SCAN domain-containing protein
                     26-like isoform X1"
                     /protein_id="XP_041379779.1"
                     /db_xref="GeneID:121392757"
                     /translation="

MLVTLVRACELCVAFGRNNIAFGRCHHYIRVQPALCLCEDPIHSRCHHYIRVQPALCLCEDPIHSRTVCEDCGQQYCGRSADRRHVVVHHGRLGGHQCTDCGRVFSIRSHLQGHHVSRFIGMNCLVFIYCLINRHYNAV"

     misc_feature    393..455
                     /gene="LOC121392757"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    480..533
                     /gene="LOC121392757"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      

ccaatgacgtaattaattcaattgtatgacgtatactaaatagtcttagcgacaaaaatggatagatctacaaattttgtttttacttttattttttagcatcacatgtcataaaaagaaatgatttgtccgtgctttgtgaacatggccacgctagcacgcacagctctctaacactacgttgtactatgttagttacgcttgtcagggcttgtgaactgtgtgttgccttcggacgtaataacattgcatttggcagatgccaccattatataagagtgcaaccagcattatgcttgtgtgaagacccgatccacagtcgatgccaccattatataagagtgcaaccagcattatgcttgtgtgaagacccgatccacagtcgaacagtttgtgaagactgcggccaacaatactgtggaaggtctgctgaccgcagacatgtggttgtccatcacggcagactaggcgggcaccagtgcactgactgtggacgagtgttttcaattaggagtcatctccaaggacaccacgtttccagattcattggaatgaattgtttagtttttatatattgtttaataaatcgacattataatgcagtttagtattagtttgttattaatcctccactggatacctaaaacaacaattctaatatatggatacatgccgtgtatctcgaataggtcaaagtgaccttgacagacccttgacctacatctgggtgttttcagatgt

//