GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-24 21:37:08, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_041105958            1636 bp    mRNA    linear   PLN 25-APR-2021
DEFINITION  PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein
            ATHB-12-like (LOC121223716), mRNA.
ACCESSION   XM_041105958
VERSION     XM_041105958.1
DBLINK      BioProject: PRJNA713846
KEYWORDS    RefSeq.
SOURCE      Gossypium hirsutum (cotton)
  ORGANISM  Gossypium hirsutum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
            Gossypium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_053447.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gossypium hirsutum Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1636
                     /organism="Gossypium hirsutum"
                     /mol_type="mRNA"
                     /isolate="1008001.06"
                     /db_xref="taxon:3635"
                     /chromosome="D11"
     gene            1..1636
                     /gene="LOC121223716"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 167 long SRA reads, 7 Proteins,
                     and 100% coverage of the annotated genomic feature by
                     RNAseq alignments, including 179 samples with support for
                     all annotated introns"
                     /db_xref="GeneID:121223716"
     CDS             399..1118
                     /gene="LOC121223716"
                     /codon_start=1
                     /product="homeobox-leucine zipper protein ATHB-12-like"
                     /protein_id="XP_040961892.1"
                     /db_xref="GeneID:121223716"
                     /translation="
MLDGEEYREEMGEPFSSVVQVTPTKKKKNKNKRRFSDEQIKSLELMFESETRLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYTILQANYDHLASKYESLKREKQALLAQLQKLNDLIKKPKEEEQCCGQVNGMRCSEGASDKGETTVKSDSEGQLSLSMGRSEHALGALSDDDSAIRTDYFGLEEEPNLMSMVDPADGSLSSPEDWRSLDSDGLFDQSPCGYQWWDFWS"
     misc_feature    498..650
                     /gene="LOC121223716"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(498..500,618..620,627..632,639..641)
                     /gene="LOC121223716"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    654..776
                     /gene="LOC121223716"
                     /note="Homeobox associated leucine zipper; Region: HALZ;
                     pfam02183"
                     /db_xref="CDD:426641"
ORIGIN      
aaaacctttactgcttccttttctaccttaaggacttacccctcaatatcttactaggatttaattaaaatttttaagggcaaaaaaatctagcacaaaagataggagtagaaatgaaaatttttataaaggcaaaagaggaaaagcactgtacgttatcagagatcccatagggtttggatataaagtaggaattagcagaatttagacatcctgtgagacccaaacccaagcagatggatacttacggttgtatataaataccagcatattcacaagtacaaacgtctaaaaacattccctgtttcttcgattcgtactgctacctactggcttgccggaccaacattcacagcacttacacaaaattttattaggaagcaaaatccagggcaaagatgttagatggggaagaatatagagaggagatgggtgagcctttttccagcgtggttcaagttacaccgactaaaaagaagaaaaacaagaacaagaggaggttcagcgatgaacaaatcaaatctctggaattgatgtttgaatcggaaaccaggcttgaacctcgaaagaagttgcaggtggctaaagagttgggtttgcagccacgacaggttgccatatggtttcagaacaagagagccaggtggaaatccaagcagcttgaacgagattacaccatcctacaagccaattacgatcatctagcttccaagtacgaaagtttaaagagagaaaagcaggccttactcgctcagttgcagaagctgaacgatttgattaagaagccgaaagaggaagagcagtgttgcggacaagttaacggtatgaggtgcagtgagggagcctcagataagggagagacgactgtgaagtctgattcagaagggcagcttagtttatcaatgggaagatcggaacatgcactaggagccttatcggatgatgatagtgccataaggacggattacttcggactggaagaagagcccaaccttatgagcatggtggatccagctgacggttctttatcctctccagaagattggcgcagtttagactctgacggtctttttgatcagtccccttgtggttaccaatggtgggatttttggtcttgaaataaccaaacaaaaacaaaactatatagaggaaaatgtatgcaaataatctttccttctctacactgggagacatgggggaaagcatgtctatgtatcattgaaatttagatgaagagaagtagattttgcggtcgtctagattctaaaacccaaacttcggcttccctggtatgtaccactttggattaagacacagaactggagttcacttgttgcttacaaatcatgtgcatatgtgtttgcatttgagactgggggagtgaggaacagtaaaggaggagcttataccacttccaatgctcaaaaaaatgatatattcaaatcactttatcagtttcctgcttctccttattggatgagcaattgtttcgtcctgcatgagattcaatcttcaattccagtactacttgtatgctgattatagcagatacgattcccctgtcctctctgaaactagaacagagggtataaacttgctatgattaatgttaatatcttggatgataaaaggctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]