2024-03-30 00:19:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039123190 783 bp mRNA linear PLN 27-JAN-2021 DEFINITION PREDICTED: Phoenix dactylifera protein DEHYDRATION-INDUCED 19 homolog 2-like (LOC120109426), mRNA. ACCESSION XM_039123190 VERSION XM_039123190.1 DBLINK BioProject: PRJNA692501 KEYWORDS RefSeq; corrected model. SOURCE Phoenix dactylifera (date palm) ORGANISM Phoenix dactylifera Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Arecaceae; Coryphoideae; Phoeniceae; Phoenix. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024069430.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Phoenix dactylifera Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 2 indels ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-181 NBZB01001783.1 43797-43977 c 182-304 NBZB01001783.1 43518-43640 c 305-391 NBZB01001783.1 43429-43515 c 392-450 NBZB01001783.1 43368-43426 c 451-783 NBZB01001783.1 36413-36745 c FEATURES Location/Qualifiers source 1..783 /organism="Phoenix dactylifera" /mol_type="mRNA" /cultivar="Barhee BC4" /db_xref="taxon:42345" /chromosome="Unknown" /sex="male" /tissue_type="young leaves" /country="USA: California" gene 1..783 /gene="LOC120109426" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 4 bases in 2 codons; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 85% coverage of the annotated genomic feature by RNAseq alignments, including 95 samples with support for all annotated introns" /db_xref="GeneID:120109426" CDS 92..553 /gene="LOC120109426" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 4 bases in 2 codons" /codon_start=1 /product="LOW QUALITY PROTEIN: protein DEHYDRATION-INDUCED 19 homolog 2-like" /protein_id="XP_038979118.1" /db_xref="GeneID:120109426" /translation="
MQLQVCPICAARVGLDLVGHITTQHGSFFKMQYRRRFRRGSPGSHSMLSLLRKDLREGNLQSLLGGSSYMAPPSAAAPDPFCQSLIYTLPVAEAIKEMYNESLDEGSLVNKSLDEKVAERVEPSLSDEDQKERARRREFVQELVLSTIFDDTL"
misc_feature <104..169 /gene="LOC120109426" /note="Drought induced 19 protein (Di19), zinc-binding; Region: zf-Di19; pfam05605" /db_xref="CDD:428539" misc_feature 233..535 /gene="LOC120109426" /note="Stress-induced protein Di19, C-terminal; Region: Di19_C; pfam14571" /db_xref="CDD:434045" ORIGIN
ttacctagcatataataccaaaattttatgattcatgtcatgtaatttttatgttgaaaaatactattaatgcttagagttgggatgaattatgcaattgcaggtatgtcccatttgtgcagctagggttggtttggacttggttgggcacataacaacacagcatggaagtttcttcaagatgcaatatagaaggagattccgcagaggttcacctgggtcccattcaatgctatctttgttgagaaaggatctaagggaaggcaatctacaatctcttcttggaggatcttcctacatggctccgccttctgctgcggcacctgatcctttctgtcaatcattgatttacactttacctgtggctgaggcaatcaaagagatgtacaacgagtctttggatgaaggaagtctggttaacaagagtttagatgaaaaggttgcagagagggtggaaccatctctatctgacgaggaccagaaggagagagctcgaaggagggaatttgtacaggagcttgtgctctctacaatatttgatgacacattatgaaggagttctctaccactatggtggctaaaggggccgttgagaaaacgccaggatcatcagcaagctgcgtcattgttgtaattgttgctcatcatctcctttggatcagtgggagcatttatttgatggttgtatatttataactgccttaagagagggaggagcatggattgtatttatacatttaacattagtatcaatatctgaagcgactatttctacaacaacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]