GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-28 13:29:08, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_037252075             612 bp    mRNA    linear   VRT 08-NOV-2020
DEFINITION  PREDICTED: Syngnathus acus prefoldin 5 (pfdn5), mRNA.
ACCESSION   XM_037252075
VERSION     XM_037252075.1
DBLINK      BioProject: PRJNA673235
KEYWORDS    RefSeq.
SOURCE      Syngnathus acus (greater pipefish)
  ORGANISM  Syngnathus acus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei;
            Syngnathidae; Syngnathus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051091.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Syngnathus acus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..612
                     /organism="Syngnathus acus"
                     /mol_type="mRNA"
                     /db_xref="taxon:161584"
                     /chromosome="5"
     gene            1..612
                     /gene="pfdn5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 14 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 81 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:119123185"
     CDS             35..490
                     /gene="pfdn5"
                     /codon_start=1
                     /product="prefoldin subunit 5"
                     /protein_id="XP_037107970.1"
                     /db_xref="GeneID:119123185"
                     /translation="
MAINLADLSLPQLEGLKSQLDQEVEFLTSSISQLKVVQAKYVDAKDNLNSLNKKNQGKELLVPLTSSMYVPGTLNDVEHVLVDVGTGYYVEKNVADSKAFFKRKLDFLTKQIEKIQPALQEKHAMKQAVIEVMNVKIQQLQQSKQASSTKA"
     misc_feature    68..436
                     /gene="pfdn5"
                     /note="Prefoldin subunit 5; Region: Prefoldin_5; cd23157"
                     /db_xref="CDD:467473"
     misc_feature    68..187
                     /gene="pfdn5"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467473"
     misc_feature    order(152..154,161..166,173..178,182..187,206..229,
                     233..262,269..283,293..310,335..337)
                     /gene="pfdn5"
                     /note="prefoldin oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:467473"
     misc_feature    317..436
                     /gene="pfdn5"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:467473"
ORIGIN      
caatccctgacgtcacactccccaggttcccaacatggcgatcaatcttgcggacctatcgctccctcagcttgagggactgaaaagccaattagaccaggaggtcgagttcctgacgtcctcaataagccagctcaaagtcgtccaggctaaatatgttgacgcaaaagataatttgaattccttaaacaaaaaaaatcaaggcaaggaattactcgtcccactcacaagttctatgtatgtgcctggaacattaaatgacgtggagcatgttttagtcgatgtgggaacaggatattatgttgaaaagaatgtagcagattccaaggcattcttcaaacgaaaactagatttcctgacaaagcaaattgagaaaattcagcccgcccttcaggaaaaacatgccatgaaacaagctgtcattgaagtcatgaatgtgaagatccaacagctacaacagagtaaacaggcttccagcaccaaggcttaattgtgacaacacttaaatgaatgctttttgtgtgtgtgaaaaagaactgtaaaatgtcctgcactgacctttatacaatctcttcttgcataatttggaaataaagggttagtgaacattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]