2024-03-28 21:13:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_037003149 464 bp mRNA linear MAM 30-OCT-2020 DEFINITION PREDICTED: Manis javanica prefoldin subunit 4-like (LOC118969262), mRNA. ACCESSION XM_037003149 VERSION XM_037003149.1 DBLINK BioProject: PRJNA666704 KEYWORDS RefSeq; corrected model. SOURCE Manis javanica (Malayan pangolin) ORGANISM Manis javanica Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Pholidota; Manidae; Manis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_023436234.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Manis javanica Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## internal stop codons :: corrected 1 genomic stop codon ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..464 /organism="Manis javanica" /mol_type="mRNA" /isolate="MJ74" /db_xref="taxon:9974" /chromosome="Unknown" /sex="female" /dev_stage="adult" /collection_date="2017" gene 1..464 /gene="LOC118969262" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:118969262" CDS 1..405 /gene="LOC118969262" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon" /codon_start=1 /transl_except=(pos:163..165,aa:OTHER) /product="LOW QUALITY PROTEIN: prefoldin subunit 4-like" /protein_id="XP_036859044.1" /db_xref="GeneID:118969262" /translation="
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIDVKKKQLQNLEDACXDLMLAEDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADKS"
misc_feature 67..375 /gene="LOC118969262" /note="Prefoldin subunit; Region: Prefoldin_2; pfam01920" /db_xref="CDD:396482" ORIGIN
atggcggccaccatgaagaaggcggctgcagaagatgttaatgttacttttgaagatcaacaaaagataaacaaatttgcacggaatacaagtagaatcacagagctgaaggaagaaatagatgtaaaaaagaaacaactccaaaatttagaagatgcttgttaggacctcatgcttgcagaagacgactgcttaatgataccttatcaaattggtgatgtttttattagccattctcaagaagaaacacaagaaatgttagaagaagccaagaaaaacttgcaagaagagattgatgccttagaatccagagtggagtcaattcagcgggtgttagcagatttgaaagttcagttatatgcaaaatttgggagcaacataaaccttgaagctgataaaagttaaacattttataatactttttaactttgtttaataaacttgaatattgtttaaaatgataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]