GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-28 21:13:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_037003149             464 bp    mRNA    linear   MAM 30-OCT-2020
DEFINITION  PREDICTED: Manis javanica prefoldin subunit 4-like (LOC118969262),
            mRNA.
ACCESSION   XM_037003149
VERSION     XM_037003149.1
DBLINK      BioProject: PRJNA666704
KEYWORDS    RefSeq; corrected model.
SOURCE      Manis javanica (Malayan pangolin)
  ORGANISM  Manis javanica
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Pholidota; Manidae; Manis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_023436234.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Manis javanica Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..464
                     /organism="Manis javanica"
                     /mol_type="mRNA"
                     /isolate="MJ74"
                     /db_xref="taxon:9974"
                     /chromosome="Unknown"
                     /sex="female"
                     /dev_stage="adult"
                     /collection_date="2017"
     gene            1..464
                     /gene="LOC118969262"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:118969262"
     CDS             1..405
                     /gene="LOC118969262"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:163..165,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: prefoldin subunit 4-like"
                     /protein_id="XP_036859044.1"
                     /db_xref="GeneID:118969262"
                     /translation="
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIDVKKKQLQNLEDACXDLMLAEDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADKS"
     misc_feature    67..375
                     /gene="LOC118969262"
                     /note="Prefoldin subunit; Region: Prefoldin_2; pfam01920"
                     /db_xref="CDD:396482"
ORIGIN      
atggcggccaccatgaagaaggcggctgcagaagatgttaatgttacttttgaagatcaacaaaagataaacaaatttgcacggaatacaagtagaatcacagagctgaaggaagaaatagatgtaaaaaagaaacaactccaaaatttagaagatgcttgttaggacctcatgcttgcagaagacgactgcttaatgataccttatcaaattggtgatgtttttattagccattctcaagaagaaacacaagaaatgttagaagaagccaagaaaaacttgcaagaagagattgatgccttagaatccagagtggagtcaattcagcgggtgttagcagatttgaaagttcagttatatgcaaaatttgggagcaacataaaccttgaagctgataaaagttaaacattttataatactttttaactttgtttaataaacttgaatattgtttaaaatgataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]