2024-04-26 20:50:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_036168105 426 bp mRNA linear ROD 23-SEP-2020 DEFINITION PREDICTED: Onychomys torridus cysteine-rich secretory protein 1-like (LOC118569849), mRNA. ACCESSION XM_036168105 VERSION XM_036168105.1 DBLINK BioProject: PRJNA664182 KEYWORDS RefSeq; includes ab initio. SOURCE Onychomys torridus (southern grasshopper mouse) ORGANISM Onychomys torridus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Neotominae; Onychomys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_050460.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Onychomys torridus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 15% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..426 /organism="Onychomys torridus" /mol_type="mRNA" /db_xref="taxon:38674" /chromosome="18" gene 1..426 /gene="LOC118569849" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:118569849" CDS 1..426 /gene="LOC118569849" /codon_start=1 /product="cysteine-rich secretory protein 1-like" /protein_id="XP_036023998.1" /db_xref="GeneID:118569849" /translation="
MILFPLLLFLAAVLPPSVLREYYENMEIEHLKTTRESVQEEIVKKHNQLRRMVYPPGSDLLKMQWSNDARVNAQRWANQCTYEDSPEDSRTTNIKCGENIFVSEYPVSWSCAIQSWYDESIDLRFGSNPFPAGYTQFRITL"
misc_feature 109..>408 /gene="LOC118569849" /note="CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family; Region: CAP; cl00133" /db_xref="CDD:412178" ORIGIN
atgatattattcccactgttgttgtttcttgctgctgtgttacccccatccgttcttcgagaatactatgagaatatggaaatcgagcatttgaaaaccactagagagtcagtccaagaagagattgtaaagaagcacaaccaactgagaagaatggtttatccacctggtagtgacttactaaagatgcaatggagcaatgatgcccgagtgaatgcacagagatgggcaaaccagtgcacttacgaagacagtcctgaagattccaggaccaccaacataaaatgtggtgagaatatcttcgtttcagagtacccagtatcatggtcttgtgcaattcaaagctggtatgatgaatccatagatttaaggtttggttcaaacccatttccagctggttatactcagttccgaatcaccctatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]