LOCUS       XM_035978673             382 bp    mRNA    linear   PLN 01-SEP-2020
DEFINITION  PREDICTED: Helianthus annuus uncharacterized LOC118483133
            (LOC118483133), mRNA.
ACCESSION   XM_035978673
VERSION     XM_035978673.1
DBLINK      BioProject: PRJNA396063
KEYWORDS    RefSeq.
SOURCE      Helianthus annuus (common sunflower)
  ORGANISM  Helianthus annuus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Heliantheae alliance; Heliantheae; Helianthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_035442.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Helianthus annuus Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..382
                     /organism="Helianthus annuus"
                     /mol_type="mRNA"
                     /cultivar="XRQ/B"
                     /specimen_voucher="SF193"
                     /db_xref="taxon:4232"
                     /chromosome="10"
                     /tissue_type="leaves"
                     /dev_stage="4 leaves"
                     /country="France"
                     /collected_by="INRA, LIPM"
     gene            1..382
                     /gene="LOC118483133"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 long SRA read, and 97% coverage
                     of the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:118483133"
     CDS             25..363
                     /gene="LOC118483133"
                     /codon_start=1
                     /product="uncharacterized protein LOC118483133"
                     /protein_id="XP_035834566.1"
                     /db_xref="GeneID:118483133"
                     /translation="

MRSLTIFLFLFSLILIASLCDARADPDNYWKIVMKDELMPTTQDAQSQDTQRSSGADNYWKIVMKDELMPTTNQDAQSQDTQRSSSADNYWKIVMKDEIMSTTIQDAPKPPK"

     misc_feature    97..>192
                     /gene="LOC118483133"
                     /note="Organ specific protein; Region: Organ_specific;
                     pfam10950"
                     /db_xref="CDD:402502"
ORIGIN      

tcaaagtctcaccaacaaaaagtcatgagatctctcacaatttttttgtttctcttctcacttattttgattgcaagtctttgtgatgcaagagcagaccctgataattactggaaaattgtaatgaaagatgagcttatgccgacgactcaggatgcccaaagccaagatacacaaagatcaagtggcgcggataattactggaaaattgtaatgaaagatgagcttatgccgacaacgaatcaggatgcccaaagccaagatacacaaagatcaagtagcgcagataattactggaaaattgtaatgaaagatgagattatgtcgacaacgattcaggatgcccctaagcctcctaagtaaagttattcagtcatcgtca

//