GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 22:31:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_030010698            1456 bp    mRNA    linear   VRT 03-MAY-2021
DEFINITION  PREDICTED: Aquila chrysaetos chrysaetos distal-less homeobox 5
            (DLX5), mRNA.
ACCESSION   XM_030010698
VERSION     XM_030010698.2
DBLINK      BioProject: PRJNA556399
KEYWORDS    RefSeq.
SOURCE      Aquila chrysaetos chrysaetos
  ORGANISM  Aquila chrysaetos chrysaetos
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Accipitriformes; Accipitridae;
            Accipitrinae; Aquila.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_044006.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 30, 2021 this sequence version replaced XM_030010698.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Aquila chrysaetos chrysaetos
                                           Annotation Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1456
                     /organism="Aquila chrysaetos chrysaetos"
                     /mol_type="mRNA"
                     /sub_species="chrysaetos"
                     /db_xref="taxon:223781"
                     /chromosome="3"
     gene            1..1456
                     /gene="DLX5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 ESTs, 17 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 8 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:115339967"
     CDS             225..1097
                     /gene="DLX5"
                     /codon_start=1
                     /product="homeobox protein DLX-5"
                     /protein_id="XP_029866558.1"
                     /db_xref="GeneID:115339967"
                     /translation="
MTGVFDRRVPNIRSGDFQAPFQTAAAMHHPSQESPTLPESSATDSDYYSPAGGAPHGYCSPTSASYGKALNPYQYQYHGMNGSAGNYPAKAYADYSYASPYHQYSGAYNRVQSSASQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHAHAHAHPPNSNPSPASSYLESSASWYPAANSINSHLQPHGSLQHPLALASGTIY"
     misc_feature    318..578
                     /gene="DLX5"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:432536"
     misc_feature    order(636..650,654..656,705..707,723..725,762..764,
                     768..773,780..785,789..797,801..806)
                     /gene="DLX5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    642..803
                     /gene="DLX5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(642..644,651..653,771..773,780..785,792..794)
                     /gene="DLX5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
tggacgagttagggtgtcgctgctcccgattgctctggccaatggaacccgatccaccctgctgtgcgtaagagcgcaattaaggatttaaccaagcctatgctgcgccccagccagcagtctgccggagacagacacagcgccgcagcctcctcccccagacatgtctgcttagacccgagcagccccagcagccagccccagccagccgccggctccgagctatgacaggagtatttgacagaagggtccccaacatcagatccggcgacttccaggctcctttccagacggccgcagccatgcaccacccgtcccaggaatctcccactttacccgagtcctcggctacggattccgactactacagcccggcggggggagccccgcacggctactgctcgcctacctcggcttcttacggcaaagcgctcaacccttaccagtatcagtaccacggcatgaacggatctgctgggaactatcctgccaaagcctacgcagactacagctacgccagcccctaccaccagtacagcggggcttacaaccgcgtacagagctccgccagccagccagagaaggaggtggcggagcccgaggtgaggatggtgaacggcaaaccaaagaaagtgcgcaaaccccggactatttattccagctttcagctggcggcgttgcagaggaggtttcagaagacccagtacctcgccctgccagagcgggccgagctggccgcctccctggggctcacgcagacacaggtgaaaatttggtttcagaataaaagatccaagatcaagaagatcatgaagaacggggagatgcccccggagcacagccccagctccagcgaccccatggcctgcaactctccacagtcgccggcggtttgggaacctcagggctcgtcccgctccctcagccaccatgcccacgcgcacgctcaccctccaaactccaacccgtcccctgcatccagctacctggagagctccgcttcctggtaccccgctgccaactccatcaactcccacctccaaccccacggctccctacagcacccgttagcgctggcctctgggacaatttattagagtctgacctttttttttttttttttttttttttttgttccttggactcctgtgttttactgttaaaggaataataacgaaaggaatgcatatgggggatttttaaagggaaaagaaacaaacaaaaagattaaaatgtgtaaagcttgtgcatgtaacttattgcatttcaaaggaaacccttttttatacaatacggacattttttggctcagctgtggacactatcaatggtgccttgaaatctatgacctcaacttttccagagactttttttcaatgttattttaaccctgtaaataattgtagatagaggaattaaactgtatattctgaataaaataaaattatttcgacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]