GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 09:52:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_029485675             575 bp    mRNA    linear   INV 15-JUN-2019
DEFINITION  PREDICTED: Acyrthosiphon pisum uncharacterized LOC115033327
            (LOC115033327), mRNA.
ACCESSION   XM_029485675
VERSION     XM_029485675.1
DBLINK      BioProject: PRJNA547584
KEYWORDS    RefSeq.
SOURCE      Acyrthosiphon pisum (pea aphid)
  ORGANISM  Acyrthosiphon pisum
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042493.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Acyrthosiphon pisum Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..575
                     /organism="Acyrthosiphon pisum"
                     /mol_type="mRNA"
                     /isolate="AL4f"
                     /isolation_source="Lab"
                     /db_xref="taxon:7029"
                     /chromosome="X"
                     /country="USA: Texas"
                     /lat_lon="30.29 N 97.73 W"
                     /collection_date="2017-11-22"
     gene            1..575
                     /gene="LOC115033327"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 2 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:115033327"
     CDS             35..448
                     /gene="LOC115033327"
                     /codon_start=1
                     /product="uncharacterized protein LOC115033327"
                     /protein_id="XP_029341535.1"
                     /db_xref="GeneID:115033327"
                     /translation="
MEQNYEDSTKDKAIMNVDKFYGDTLFENYQDLNKNKTRNSNSNKDELTGRIPIASALGGDTLVKKKKKKKKEDKHMEQNYEDSTKDKAIMNVDKFYGDTLFENYHDLNKEETRDSNSNKDELTGRIPIASASEGDTL"
ORIGIN      
aaagaagaagaagaaaaagaaggaagataaacatatggaacaaaattatgaagattcgacaaaggataaagccattatgaatgtagataagttttatggtgatacactttttgaaaattatcaagatttgaataaaaacaaaacaaggaattcaaattcaaacaaagatgaactgacaggaagaattcctattgccagtgctttgggaggagacactttagttaaaaagaagaagaagaaaaagaaggaagataaacatatggaacaaaattatgaagattcgacaaaggataaagccattatgaatgtagataagttttatggtgatacactttttgaaaattatcatgatttgaataaagaagaaacaagggattcaaattcaaacaaagatgaattgacaggaagaattcctattgccagtgcttcggaaggggacactttgtaagtatctatgaaagttaaaatcgctttacataatcacatttttatttattgtacagtcaatgataaataagttaattaattttgtttaacattatattaaaatatttttgtatgtgatattgtatttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]