2024-04-27 09:52:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_029485675 575 bp mRNA linear INV 15-JUN-2019 DEFINITION PREDICTED: Acyrthosiphon pisum uncharacterized LOC115033327 (LOC115033327), mRNA. ACCESSION XM_029485675 VERSION XM_029485675.1 DBLINK BioProject: PRJNA547584 KEYWORDS RefSeq. SOURCE Acyrthosiphon pisum (pea aphid) ORGANISM Acyrthosiphon pisum Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_042493.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Acyrthosiphon pisum Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..575 /organism="Acyrthosiphon pisum" /mol_type="mRNA" /isolate="AL4f" /isolation_source="Lab" /db_xref="taxon:7029" /chromosome="X" /country="USA: Texas" /lat_lon="30.29 N 97.73 W" /collection_date="2017-11-22" gene 1..575 /gene="LOC115033327" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:115033327" CDS 35..448 /gene="LOC115033327" /codon_start=1 /product="uncharacterized protein LOC115033327" /protein_id="XP_029341535.1" /db_xref="GeneID:115033327" /translation="
MEQNYEDSTKDKAIMNVDKFYGDTLFENYQDLNKNKTRNSNSNKDELTGRIPIASALGGDTLVKKKKKKKKEDKHMEQNYEDSTKDKAIMNVDKFYGDTLFENYHDLNKEETRDSNSNKDELTGRIPIASASEGDTL"
ORIGIN
aaagaagaagaagaaaaagaaggaagataaacatatggaacaaaattatgaagattcgacaaaggataaagccattatgaatgtagataagttttatggtgatacactttttgaaaattatcaagatttgaataaaaacaaaacaaggaattcaaattcaaacaaagatgaactgacaggaagaattcctattgccagtgctttgggaggagacactttagttaaaaagaagaagaagaaaaagaaggaagataaacatatggaacaaaattatgaagattcgacaaaggataaagccattatgaatgtagataagttttatggtgatacactttttgaaaattatcatgatttgaataaagaagaaacaagggattcaaattcaaacaaagatgaattgacaggaagaattcctattgccagtgcttcggaaggggacactttgtaagtatctatgaaagttaaaatcgctttacataatcacatttttatttattgtacagtcaatgataaataagttaattaattttgtttaacattatattaaaatatttttgtatgtgatattgtatttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]