LOCUS       XM_023691470             976 bp    mRNA    linear   PLN 22-JAN-2018
DEFINITION  PREDICTED: Cucurbita pepo subsp. pepo paired amphipathic helix
            protein Sin3-like 3 (LOC111806112), mRNA.
ACCESSION   XM_023691470
VERSION     XM_023691470.1
DBLINK      BioProject: PRJNA421955
KEYWORDS    RefSeq.
SOURCE      Cucurbita pepo subsp. pepo (vegetable marrow)
  ORGANISM  Cucurbita pepo subsp. pepo
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae;
            Cucurbiteae; Cucurbita.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_036648.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cucurbita pepo subsp. pepo
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Cucurbita pepo subsp. pepo"
                     /mol_type="mRNA"
                     /cultivar="mu-cu-16"
                     /sub_species="pepo"
                     /db_xref="taxon:3664"
                     /chromosome="LG11"
                     /tissue_type="young leaf"
                     /dev_stage="seedling"
                     /country="Spain: Murcia"
     gene            1..976
                     /gene="LOC111806112"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111806112"
     CDS             60..875
                     /gene="LOC111806112"
                     /codon_start=1
                     /product="paired amphipathic helix protein Sin3-like 3"
                     /protein_id="XP_023547238.1"
                     /db_xref="GeneID:111806112"
                     /translation="

MKNRGEADGSIRKLTAEDALEFLKNVKDVIGNETEKYEEFLQLMKDLAFQRIDIVGVITGVKRLFRGHNDLILGFNTFLPQRYAIACPLEDETPPRRRRPLKLGDALDYVSEVKRRFEGEFHIFNSFMRNLHLYKRGKKPLSELHREVCVLMQDHPDLVEGFADFLPCPSLTTTSNNDPEQNIGVDRPDEEGMSLIEKMNQKLREVDVPQQFVKCLDVFDREIITPSELHSMVALLLITRVADVDTEHSEDFYKRSTFRNGCRITNITLKK"

     misc_feature    60..>560
                     /gene="LOC111806112"
                     /note="Histone deacetylase complex, regulatory component
                     SIN3 [Chromatin structure and dynamics]; Region: Sin3;
                     COG5602"
                     /db_xref="CDD:227889"
ORIGIN      

tttgttctactgctcaactcttgctcattcgacaaagcttccgcagattttcttcagaaatgaagaaccgcggggaggcagatggaagtatccggaaattaacagcggaggatgccttagaatttctcaagaatgtgaaggacgtcattggaaacgagacggaaaaatatgaagaatttcttcaactcatgaaggatttagcgtttcaaagaattgacattgtgggcgtcataacaggggtaaagcgtctattcagaggtcataatgacctgattttgggctttaatacttttttgccacaaagatatgcaatagcttgtcctcttgaggatgaaacgcctcctcgaaggaggcggcctcttaaacttggagacgctttggactatgtcagtgaggttaagagacggtttgaaggtgagttccatatattcaattcatttatgagaaatttgcatttgtacaaaagaggaaaaaagcctctaagtgagctccaccgggaggtttgtgtactgatgcaagaccacccagaccttgttgagggttttgctgattttcttccttgtccttcactcacaacaacctcaaacaatgatcctgagcagaacattggtgttgaccgtcctgatgaagaaggtatgtctttaattgagaagatgaatcaaaagttacgagaagttgacgttccacaacaatttgtgaaatgccttgatgtttttgacagggaaataatcactccatcggaactgcattctatggtggctcttctactaattacacgtgtagctgacgtggacacggaacacagtgaagatttctataagcgttcaactttcaggaatggatgcaggattacaaatatcaccttgaaaaaatgacaatgaccaatccaaaagccataaacaaaaaaaattgaagtaattaaacacaaaatcaatagtttaaaaatatagcagatatcatttaggggtagtaacat

//