GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 21:24:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_023667227             581 bp    mRNA    linear   PLN 22-JAN-2018
DEFINITION  PREDICTED: Cucurbita pepo subsp. pepo paired amphipathic helix
            protein Sin3-like 4 (LOC111787080), partial mRNA.
ACCESSION   XM_023667227
VERSION     XM_023667227.1
DBLINK      BioProject: PRJNA421955
KEYWORDS    RefSeq.
SOURCE      Cucurbita pepo subsp. pepo (vegetable marrow)
  ORGANISM  Cucurbita pepo subsp. pepo
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae;
            Cucurbiteae; Cucurbita.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019650901.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cucurbita pepo subsp. pepo
                                           Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..581
                     /organism="Cucurbita pepo subsp. pepo"
                     /mol_type="mRNA"
                     /cultivar="mu-cu-16"
                     /sub_species="pepo"
                     /db_xref="taxon:3664"
                     /chromosome="Unknown"
                     /tissue_type="young leaf"
                     /dev_stage="seedling"
                     /country="Spain: Murcia"
     gene            1..>581
                     /gene="LOC111787080"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 30 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111787080"
     CDS             243..>581
                     /gene="LOC111787080"
                     /codon_start=1
                     /product="paired amphipathic helix protein Sin3-like 4"
                     /protein_id="XP_023522995.1"
                     /db_xref="GeneID:111787080"
                     /translation="
MVGGGSIQKLTTNDALEYLKNVKDIFRDKKETYEDFLEVMKEFKAQRIDTAGVIARVKHLFKGHRDLILGFNTFLPKGFAITCSPEDETPPQKKKPVQFEEAINFVGKIKVIK"
     misc_feature    270..>563
                     /gene="LOC111787080"
                     /note="Histone deacetylase complex, regulatory component
                     SIN3 [Chromatin structure and dynamics]; Region: Sin3;
                     COG5602"
                     /db_xref="CDD:227889"
ORIGIN      
tgctttaacttgatgcgaaatatactgatttatgctctaggattttccatttaatgaatccatctgaatgaatactatgatcaggacagatggtttgccaaattaactaatgagaagtgcttatttgtgcaatattttttcttgagactccttcagttgtgagttctatagatcaccgtaatcaccagatctttatatttttctgtatgtcgccttgggaatgaagaactgtgcagagccagatggtgggaggtggcagtattcagaaactaacaacgaatgatgccctagaatatcttaagaatgtcaaggacatcttccgagacaagaaggaaacatatgaagattttcttgaagttatgaaagaattcaaggctcaaagaattgatactgccggtgtcatagcaagagtaaagcatctatttaaaggtcatcgtgacctgattttgggctttaatacttttttgcccaaaggatttgcaataacttgttctcctgaggatgaaacacctcctcaaaagaagaagcctgttcaatttgaagaagctatcaactttgtcggtaagattaaggtaattaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]