2024-04-26 21:24:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_023667227 581 bp mRNA linear PLN 22-JAN-2018 DEFINITION PREDICTED: Cucurbita pepo subsp. pepo paired amphipathic helix protein Sin3-like 4 (LOC111787080), partial mRNA. ACCESSION XM_023667227 VERSION XM_023667227.1 DBLINK BioProject: PRJNA421955 KEYWORDS RefSeq. SOURCE Cucurbita pepo subsp. pepo (vegetable marrow) ORGANISM Cucurbita pepo subsp. pepo Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019650901.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Cucurbita pepo subsp. pepo Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..581 /organism="Cucurbita pepo subsp. pepo" /mol_type="mRNA" /cultivar="mu-cu-16" /sub_species="pepo" /db_xref="taxon:3664" /chromosome="Unknown" /tissue_type="young leaf" /dev_stage="seedling" /country="Spain: Murcia" gene 1..>581 /gene="LOC111787080" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns" /db_xref="GeneID:111787080" CDS 243..>581 /gene="LOC111787080" /codon_start=1 /product="paired amphipathic helix protein Sin3-like 4" /protein_id="XP_023522995.1" /db_xref="GeneID:111787080" /translation="
MVGGGSIQKLTTNDALEYLKNVKDIFRDKKETYEDFLEVMKEFKAQRIDTAGVIARVKHLFKGHRDLILGFNTFLPKGFAITCSPEDETPPQKKKPVQFEEAINFVGKIKVIK"
misc_feature 270..>563 /gene="LOC111787080" /note="Histone deacetylase complex, regulatory component SIN3 [Chromatin structure and dynamics]; Region: Sin3; COG5602" /db_xref="CDD:227889" ORIGIN
tgctttaacttgatgcgaaatatactgatttatgctctaggattttccatttaatgaatccatctgaatgaatactatgatcaggacagatggtttgccaaattaactaatgagaagtgcttatttgtgcaatattttttcttgagactccttcagttgtgagttctatagatcaccgtaatcaccagatctttatatttttctgtatgtcgccttgggaatgaagaactgtgcagagccagatggtgggaggtggcagtattcagaaactaacaacgaatgatgccctagaatatcttaagaatgtcaaggacatcttccgagacaagaaggaaacatatgaagattttcttgaagttatgaaagaattcaaggctcaaagaattgatactgccggtgtcatagcaagagtaaagcatctatttaaaggtcatcgtgacctgattttgggctttaatacttttttgcccaaaggatttgcaataacttgttctcctgaggatgaaacacctcctcaaaagaagaagcctgttcaatttgaagaagctatcaactttgtcggtaagattaaggtaattaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]