LOCUS       XM_020078377             630 bp    mRNA    linear   VRT 08-FEB-2017
DEFINITION  PREDICTED: Paralichthys olivaceus mitofusin-1-like (LOC109623919),
            partial mRNA.
ACCESSION   XM_020078377
VERSION     XM_020078377.1
DBLINK      BioProject: PRJNA369269
KEYWORDS    RefSeq.
SOURCE      Paralichthys olivaceus (Japanese flounder)
  ORGANISM  Paralichthys olivaceus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei;
            Paralichthyidae; Paralichthys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_017868986.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Paralichthys olivaceus Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..630
                     /organism="Paralichthys olivaceus"
                     /mol_type="mRNA"
                     /db_xref="taxon:8255"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /breed="gynogenesis"
     gene            1..>630
                     /gene="LOC109623919"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 8 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:109623919"
     CDS             200..>630
                     /gene="LOC109623919"
                     /codon_start=1
                     /product="mitofusin-1-like"
                     /protein_id="XP_019933936.1"
                     /db_xref="GeneID:109623919"
                     /translation="

MSEAWRSDDLGQVAVEEQSVDMQSCATKLSTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLRVEGTDGDEAYLTTEASNERRSVTTVNQLAHALHMDPTLDSGSLVRVFWPKSCCALLRDDLVLMD"

     misc_feature    326..>630
                     /gene="LOC109623919"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl38936"
                     /db_xref="CDD:453896"
     misc_feature    338..361
                     /gene="LOC109623919"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    419..421
                     /gene="LOC109623919"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    425..433
                     /gene="LOC109623919"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
ORIGIN      

acatgttacgttcacgatgaggtcactatgacctttgacctctgaaatctaatcaattcatctttcaaccagttttgaggaaattccttcgaggtgttgttgagatatcgtgttgacaagaaagaaacagcctctgaccactgggggtcgctggtgtaaacaatacaaacgtgacaatgtgacctgtgtttgttgcgtgatgtcagaggcatggcggagcgacgacctgggccaggtggcggtggaggagcagagcgtggacatgcagagctgtgccaccaaactgtcgaccatcagggacgttttgctgcggaggcacatgaaggtggcgttctttggcagaactagtaacgggaaaagtaccgtgatcaacgccatgttgagagaccgagtgttgcccagcggcattggtcacaccaccaactgcttcctgagggtggaaggaaccgacggagacgaggcttacctcaccaccgaggcgtccaatgagaggcggagcgtcactacggtcaaccagctcgctcacgcgctccacatggatccaactctagattccggcagcctcgtcagagtgttctggcctaaaagttgctgcgctctgctgagagacgacctggtgctgatggacag

//