2024-04-20 14:50:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_016875482 1427 bp mRNA linear PLN 25-APR-2021 DEFINITION PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein ATHB-12 (LOC107941859), mRNA. ACCESSION XM_016875482 VERSION XM_016875482.2 DBLINK BioProject: PRJNA713846 KEYWORDS RefSeq. SOURCE Gossypium hirsutum (cotton) ORGANISM Gossypium hirsutum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_053434.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 25, 2021 this sequence version replaced XM_016875482.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gossypium hirsutum Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1427 /organism="Gossypium hirsutum" /mol_type="mRNA" /isolate="1008001.06" /db_xref="taxon:3635" /chromosome="A11" gene 1..1427 /gene="LOC107941859" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 long SRA reads, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 156 samples with support for all annotated introns" /db_xref="GeneID:107941859" CDS 187..906 /gene="LOC107941859" /codon_start=1 /product="homeobox-leucine zipper protein ATHB-12" /protein_id="XP_016730971.2" /db_xref="GeneID:107941859" /translation="
MLDGEEYREEMGEPFSSVAQVTPTKKKKNKNKRRFSDEQIKSLELMFESETRLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYTILQANYDLLASKYESLKREKQALLTQLQKLNDLIKKPKEEEQCCGQVNGMRCSEGASDKGETTVKSDSEGQLSLSMGRSEHALGALSDDDSAIRTDYFGLEEEPNLMSMVDPADGSLSSPEDWRSLDSDGLFDQSPCGYQWWDFWS"
misc_feature 286..438 /gene="LOC107941859" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(286..288,406..408,415..420,427..429) /gene="LOC107941859" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 442..564 /gene="LOC107941859" /note="Homeobox associated leucine zipper; Region: HALZ; pfam02183" /db_xref="CDD:426641" ORIGIN
acatcctatgacacccaaacccaagcagacggatacttacggttgtatataaataccagcatactcacaagtacaaacgtctaaaaacattccctgtttcttcgattcgtactgctacctactggcttgccggaccaacattcgcggcacttaaaaatttattaggaagcaaaattcagggcaaagatgttagatggggaagaatatagagaggagatgggtgagcctttttccagcgtggctcaagttacaccaactaaaaagaagaaaaacaagaacaagaggaggttcagcgatgaacaaatcaaatctctggaattgatgtttgaatcggaaaccaggcttgaacctcgaaagaagttgcaggtggctaaagagttgggtttgcagccacgacaggttgccatatggtttcagaacaagagagccaggtggaaatccaagcagcttgaacgagattacaccatcctacaagccaattacgatcttctagcttccaagtacgaaagtttaaagagagaaaagcaggccttactcactcagttgcagaagctgaacgatttgattaagaagccgaaagaggaagagcagtgttgcggacaagttaacggtatgaggtgcagtgagggagcctcagataagggagagacgactgtgaagtctgattcagaagggcagcttagtttatcaatgggaagatcggaacatgctctaggagctttatcggatgatgatagtgccataaggacggattacttcggactggaagaagagcccaaccttatgagcatggtggatccagctgacggttctttatcctctccagaagattggcgtagtttagactctgatggtctttttgatcagtccccttgtggttaccaatggtgggatttttggtcttgaaataaccaaacaaaaacaaaactatatagaggaaaatgtatgcaaataatctttccttctttacactgggagacatgggggaaagcatgtctatgtatcattgaaatttagatgaagagaagtagattttgcggtcgtctagattctaaaacccaaaattcggcatccctggtatgtaccactttggattaggacacagaactggagttcacttgttgcttacaaatcatgtgcagatgtgtttgcatttgagactgggagagtggggaacggtaaaggaggagcttataccacttccaatgctaaaaaaaaaacgatatattcaaatcacttcatcagtttcctgcttctccttattggtttgtgcaattgtttcgtcctgcatgagattcaatcttcaattccagtacttgttatatgctgattatatcagattagattcccatgtcctctctgaaactagaacagagagtataaacttgctatgattaatgttaatatcttggatgatacaaggctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]