LOCUS       XM_016875482            1427 bp    mRNA    linear   PLN 25-APR-2021
DEFINITION  PREDICTED: Gossypium hirsutum homeobox-leucine zipper protein
            ATHB-12 (LOC107941859), mRNA.
ACCESSION   XM_016875482
VERSION     XM_016875482.2
DBLINK      BioProject: PRJNA713846
KEYWORDS    RefSeq.
SOURCE      Gossypium hirsutum (cotton)
  ORGANISM  Gossypium hirsutum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae;
            Gossypium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_053434.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 25, 2021 this sequence version replaced XM_016875482.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gossypium hirsutum Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1427
                     /organism="Gossypium hirsutum"
                     /mol_type="mRNA"
                     /isolate="1008001.06"
                     /db_xref="taxon:3635"
                     /chromosome="A11"
     gene            1..1427
                     /gene="LOC107941859"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 19 long SRA reads, 4 Proteins, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 156 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:107941859"
     CDS             187..906
                     /gene="LOC107941859"
                     /codon_start=1
                     /product="homeobox-leucine zipper protein ATHB-12"
                     /protein_id="XP_016730971.2"
                     /db_xref="GeneID:107941859"
                     /translation="

MLDGEEYREEMGEPFSSVAQVTPTKKKKNKNKRRFSDEQIKSLELMFESETRLEPRKKLQVAKELGLQPRQVAIWFQNKRARWKSKQLERDYTILQANYDLLASKYESLKREKQALLTQLQKLNDLIKKPKEEEQCCGQVNGMRCSEGASDKGETTVKSDSEGQLSLSMGRSEHALGALSDDDSAIRTDYFGLEEEPNLMSMVDPADGSLSSPEDWRSLDSDGLFDQSPCGYQWWDFWS"

     misc_feature    286..438
                     /gene="LOC107941859"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(286..288,406..408,415..420,427..429)
                     /gene="LOC107941859"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    442..564
                     /gene="LOC107941859"
                     /note="Homeobox associated leucine zipper; Region: HALZ;
                     pfam02183"
                     /db_xref="CDD:426641"
ORIGIN      

acatcctatgacacccaaacccaagcagacggatacttacggttgtatataaataccagcatactcacaagtacaaacgtctaaaaacattccctgtttcttcgattcgtactgctacctactggcttgccggaccaacattcgcggcacttaaaaatttattaggaagcaaaattcagggcaaagatgttagatggggaagaatatagagaggagatgggtgagcctttttccagcgtggctcaagttacaccaactaaaaagaagaaaaacaagaacaagaggaggttcagcgatgaacaaatcaaatctctggaattgatgtttgaatcggaaaccaggcttgaacctcgaaagaagttgcaggtggctaaagagttgggtttgcagccacgacaggttgccatatggtttcagaacaagagagccaggtggaaatccaagcagcttgaacgagattacaccatcctacaagccaattacgatcttctagcttccaagtacgaaagtttaaagagagaaaagcaggccttactcactcagttgcagaagctgaacgatttgattaagaagccgaaagaggaagagcagtgttgcggacaagttaacggtatgaggtgcagtgagggagcctcagataagggagagacgactgtgaagtctgattcagaagggcagcttagtttatcaatgggaagatcggaacatgctctaggagctttatcggatgatgatagtgccataaggacggattacttcggactggaagaagagcccaaccttatgagcatggtggatccagctgacggttctttatcctctccagaagattggcgtagtttagactctgatggtctttttgatcagtccccttgtggttaccaatggtgggatttttggtcttgaaataaccaaacaaaaacaaaactatatagaggaaaatgtatgcaaataatctttccttctttacactgggagacatgggggaaagcatgtctatgtatcattgaaatttagatgaagagaagtagattttgcggtcgtctagattctaaaacccaaaattcggcatccctggtatgtaccactttggattaggacacagaactggagttcacttgttgcttacaaatcatgtgcagatgtgtttgcatttgagactgggagagtggggaacggtaaaggaggagcttataccacttccaatgctaaaaaaaaaacgatatattcaaatcacttcatcagtttcctgcttctccttattggtttgtgcaattgtttcgtcctgcatgagattcaatcttcaattccagtacttgttatatgctgattatatcagattagattcccatgtcctctctgaaactagaacagagagtataaacttgctatgattaatgttaatatcttggatgatacaaggctaa

//