2024-05-08 14:03:33, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_015902947 1665 bp mRNA linear INV 14-MAR-2016 DEFINITION PREDICTED: Acropora digitifera myosin-11-like (LOC107337720), mRNA. ACCESSION XM_015902947 VERSION XM_015902947.1 DBLINK BioProject: PRJNA314803 KEYWORDS RefSeq; includes ab initio. SOURCE Acropora digitifera ORGANISM Acropora digitifera Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia; Astrocoeniina; Acroporidae; Acropora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_015441161.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Acropora digitifera Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 21% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1665 /organism="Acropora digitifera" /mol_type="mRNA" /db_xref="taxon:70779" /chromosome="Unknown" /country="Japan:Okinawa, Kunigami, Oku" gene 1..1665 /gene="LOC107337720" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 78% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:107337720" CDS 1..1665 /gene="LOC107337720" /codon_start=1 /product="myosin-11-like" /protein_id="XP_015758433.1" /db_xref="GeneID:107337720" /translation="
MSRSTPGNQHYSLMLHWFKMSATLKVCSFFMRHKSTIGKSERCVEVQTTFEAHRDFELGTPVEFPVSGGHPRFGVIRWIGNIPQEKDHLIVGLELEQKTSAFCDGTLNGTRYFTCEPGRGFFCILESCRKDSRQTSNSQNNDNILPGKDEQCEENAFSRQLASLDSSSYQQALEDIQQLINENNKLNLEKCQWEKEKNDVQQEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRANESQVHKLETSLTTVQQALEDMQQLKDENSRLKLEKCQLEKDKNDVQEEKDELVVQNNSLQTDLRAKETQVHELETSLTTAQQALENMQQLEIRHKGLKLEKCQLEKEKNVVQQEKDELVVQNNSLQTDLRAKETQVDVYSFGVLFCEMCIREMPDPQRRHQQVLLMRNRVLRSVVLKCVRVNPAERPDMPQIIQEIEKFEG"
misc_feature 172..387 /gene="LOC107337720" /note="Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network; Region: CAP_GLY; smart01052" /db_xref="CDD:214997" misc_feature 583..>1458 /gene="LOC107337720" /note="Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning]; Region: Smc; COG1196" /db_xref="CDD:224117" misc_feature <1462..1647 /gene="LOC107337720" /note="Protein Kinases, catalytic domain; Region: PKc_like; cl21453" /db_xref="CDD:451246" ORIGIN
atgtctagatccacccctggcaatcaacattacagtttgatgctgcactggtttaaaatgagtgcaacgttaaaagtgtgtagtttcttcatgagacacaaaagcacaataggaaaatctgaaaggtgtgttgaagttcaaacaacctttgaagctcatcgtgactttgaactgggcactcctgtcgagtttcccgtgtcaggaggtcacccaagatttggtgtcatacgatggattggaaatattccacaagaaaaggatcatcttattgttggcttggagttggagcagaaaacgtctgctttttgcgatggaacattgaatggaacgagatatttcacctgtgaaccaggaagaggtttcttctgtattttggagagctgcagaaaagactcacgccaaacttcaaattcacaaaacaatgataacattcttcctggcaaagatgaacagtgtgaagaaaatgcattttcaaggcaattagcttcacttgactcatcttcatatcaacaagctttggaagacatccagcaactgataaatgaaaacaacaaattgaatcttgaaaaatgccagtgggagaaagagaaaaatgatgtgcaacaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaatgaatcccaagtacacaaactagaaacatctctcactacagttcaacaagctttggaggatatgcagcaactgaaagatgaaaacagcagattaaagcttgaaaagtgccagttggagaaagacaagaatgatgtgcaagaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaaggaaactcaggtgcacgaactggaaacatctctcactacagctcaacaagctttggagaatatgcagcaactggaaattcgccacaaaggattgaagcttgaaaaatgccagttggagaaagagaaaaatgttgtgcaacaagaaaaggatgaacttgtggttcaaaacaatagtttgcaaacagatttgagagcaaaggaaactcaggttgatgtgtacagctttggtgtccttttctgtgaaatgtgcattcgggaaatgccagatccacaaagacgtcatcaacaagttcttcttatgagaaaccgtgttctaaggagcgtagtgcttaaatgcgtgagggtcaatccagctgagagacctgacatgccacaaattatccaagaaatagaaaagtttgaaggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]