GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-30 11:33:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_015357071            1121 bp    mRNA    linear   VRT 08-JAN-2016
DEFINITION  PREDICTED: Lepisosteus oculatus testis- and ovary-specific PAZ
            domain-containing protein 1-like (LOC107078576), transcript variant
            X1, mRNA.
ACCESSION   XM_015357071
VERSION     XM_015357071.1
DBLINK      BioProject: PRJNA221149
KEYWORDS    RefSeq.
SOURCE      Lepisosteus oculatus (spotted gar)
  ORGANISM  Lepisosteus oculatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Holostei; Semionotiformes;
            Lepisosteidae; Lepisosteus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006269976.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Lepisosteus oculatus Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1121
                     /organism="Lepisosteus oculatus"
                     /mol_type="mRNA"
                     /isolate="Spotted Gar 1"
                     /db_xref="taxon:7918"
                     /sex="female"
                     /country="USA: Bayou Chevreuil, St. James Parish,
                     Louisiana"
                     /lat_lon="29.91 N 90.80 W"
                     /linkage_group="LG11"
     gene            1..1121
                     /gene="LOC107078576"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:107078576"
     CDS             510..1025
                     /gene="LOC107078576"
                     /codon_start=1
                     /product="testis- and ovary-specific PAZ domain-containing
                     protein 1-like isoform X1"
                     /protein_id="XP_015212557.1"
                     /db_xref="GeneID:107078576"
                     /translation="
MVCKKIPVNFVLLRNLIDRLGRQSLWVKARSLYKCALHLGCYPPVKENTYCRLLSVPCSLTEIEMTLAFEMFMVSNANSIQNPSTCTHALQIVLKSRFLPRKEEDGSISECDYHAAVSRLVSAAQITRPKLVIKYATVNVCGEQVFTLDPLSALKWLSQNMEWAGKAWLVS"
ORIGIN      
aaggtgctcgaaatggacttttcatagcttaaaatgtcatctctccctcgatagatgtctatccttgtgaatgcgtacaaggtcgtgtgttgaagagatgtggctggtgacagactgtcggtatcagatgtgcacagtgccttattgatgaagttctgaccatgaagggagaatctcaggggtcccgtgtcttttacagttggacatcctcctgcatctcatgtagtgccacagaagtggagagtctttcataaacatttaatcatagttgccagttttaggcggcacagtttccagcctctttcggtgccattggcttatccttgaaagccaaggtgtacattgaaggagggcagggccatgacttactgtcctctgttcatgaaagtctttttttttcagtttcagatgcaccatctgtttcccagtgtgttccagttttcaacagactcttaaagtgttgcattgagcagcacaatttgacagtgtcgtccaacgctgtggacttcatggtgtgcaagaagatacctgtgaactttgtcctgctcaggaacttaattgacagattgggaagacagtctttgtgggtgaaggcaagatccctatacaaatgtgcgctgcatctgggctgctacccccctgtcaaagaaaacacgtactgcaggcttctctccgttccctgctccctgaccgagatcgagatgacactggcctttgaaatgttcatggtttcaaatgcaaacagcattcagaatccaagtacttgtacacacgctctacagattgtactgaaaagtcgttttctccccaggaaagaggaagatgggtcgatcagtgaatgtgactaccatgcagctgtgagcagactcgtgtcggctgcccagatcaccaggccgaagctggtgattaaatatgccaccgtcaacgtctgcggagagcaggtgttcacgctggaccctctgtcggctctgaagtggctgagccagaacatggagtgggctgggaaggcctggctggtttcctgacgtcttcaaggagcccgtcaaagaagagctgcaacgttgtacattaatcattaatgtatggtgcacaataaagatgaagataggtttttcagatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]