LOCUS       XM_014684551             465 bp    mRNA    linear   PLN 05-JAN-2024
DEFINITION  Metarhizium brunneum ARSEF 3297 uncharacterized protein
            (MBR_09803), partial mRNA.
ACCESSION   XM_014684551
VERSION     XM_014684551.1
DBLINK      BioProject: PRJNA302307
            BioSample: SAMN03268432
KEYWORDS    RefSeq.
SOURCE      Metarhizium brunneum ARSEF 3297
  ORGANISM  Metarhizium brunneum ARSEF 3297
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae;
            Metarhizium.
REFERENCE   1  (bases 1 to 465)
  AUTHORS   Hu,X., Xiao,G., Zheng,P., Shang,Y., Su,Y., Zhang,X., Liu,X.,
            Zhan,S., St Leger,R.J. and Wang,C.
  TITLE     Trajectory and genomic determinants of fungal-pathogen speciation
            and host adaptation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 111 (47), 16796-16801 (2014)
   PUBMED   25368161
REFERENCE   2  (bases 1 to 465)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 465)
  AUTHORS   Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and
            Wang,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2013) Institute of Plant Physiology and Ecology,
            Shanghai Institutes for Biological Sciences, 300 Fengling Road,
            Shanghai, Shanghai 200032, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_014574691).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..465
                     /organism="Metarhizium brunneum ARSEF 3297"
                     /mol_type="mRNA"
                     /strain="ARSEF 3297"
                     /host="Boophilus sp."
                     /db_xref="taxon:1276141"
                     /chromosome="Unknown"
                     /country="Mexico: Colima"
                     /collection_date="1987"
     gene            <1..>465
                     /locus_tag="MBR_09803"
                     /db_xref="GeneID:26247073"
     CDS             <1..465
                     /locus_tag="MBR_09803"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_014540037.1"
                     /db_xref="GeneID:26247073"
                     /translation="

MANSAKRILVSVSSKSPYWSEAWESSLQVIETALGLLKESKLVCSDGNQDAKPKFIVKERWNVRTFIVFDIFHDTYDPDTAHLSGQNDLPVISVFLGEIISMNVASNFVENEVNRKVQEIHDATGIGSRPPFSVDHMYGNVPSYPNPRTIISPP"

ORIGIN      

atggcaaactctgcgaagcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcttgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgttaaggagagatggaatgtgcgaacatttatcgtcttcgacatcttccacgacacctacgatcccgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagataatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtgcaagaaatccacgatgcgactggaatcggaagtcggcctcctttcagcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactataatatctcctccttga

//