LOCUS       XM_011660108             844 bp    mRNA    linear   PLN 17-DEC-2019
DEFINITION  PREDICTED: Cucumis sativus kiwellin (LOC105435992), mRNA.
ACCESSION   XM_011660108
VERSION     XM_011660108.2
DBLINK      BioProject: PRJNA182750
KEYWORDS    RefSeq.
SOURCE      Cucumis sativus (cucumber)
  ORGANISM  Cucumis sativus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae;
            Benincaseae; Cucumis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_026660.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 17, 2019 this sequence version replaced XM_011660108.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cucumis sativus Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..844
                     /organism="Cucumis sativus"
                     /mol_type="mRNA"
                     /cultivar="9930"
                     /db_xref="taxon:3659"
                     /chromosome="6"
                     /tissue_type="leaf"
     gene            1..844
                     /gene="LOC105435992"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 4 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:105435992"
     CDS             59..718
                     /gene="LOC105435992"
                     /codon_start=1
                     /product="kiwellin"
                     /protein_id="XP_011658410.1"
                     /db_xref="GeneID:105435992"
                     /translation="

MAKLGWLVVSLSVSVLVTNLCEAISSCNDPCKTLNDCDGQLICIKGKCNNDPDVHVGSHVCSNEGSGEGSSPPLGDSCQPFGHKVCKGISHPQFKCSPRVTSSTRAILTNIEFNGDGENGAPSECDNKFHLNSELVVALSTGWYNRGSRCGKKIKVTARNGKSVLAKVVDECDSISGCDALHAGQPPCRNNIVDAAKAVWDALGLDTDVGEEPVNWSDV"

     misc_feature    329..712
                     /gene="LOC105435992"
                     /note="double-psi beta-barrel fold of the kiwellin family;
                     Region: DPBB_kiwellin-like; cd22270"
                     /db_xref="CDD:439250"
     misc_feature    order(335..337,341..343,422..439,497..502,506..508,
                     566..571,575..577)
                     /gene="LOC105435992"
                     /note="putative effector binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:439250"
ORIGIN      

aagaaagagtctttttttttcattgaacacttcatcaatctatctcttgaaaaacttaatggccaagttgggatggttggttgtttctctttctgtttctgtacttgttaccaatctttgtgaagcaatctcttcttgtaatgacccatgtaaaactctaaatgattgcgatggacagttgatttgtatcaaaggtaaatgcaacaatgatcctgatgtacatgtgggtagtcatgtgtgttcaaacgaaggcagtggagaagggtcttcaccaccattaggcgatagttgtcaaccttttggccacaaagtttgtaagggaatatcacatccacagttcaagtgctcgcctcgagtgacttcctcgactagagctatccttacaaacatcgaattcaacggagatggtgagaacggagccccgtcagagtgcgacaataaattccatcttaactctgaattagtagtggcattgtctacaggttggtataataggggttcgaggtgtggaaagaagatcaaagttactgcgaggaatggaaagtctgtgttggctaaggtggtagatgagtgtgattcgataagcggatgtgatgcgctacatgctggtcaaccaccttgccgaaataatatcgtggatgctgcaaaagcagtatgggacgctttgggacttgacacagatgtaggtgaagagcctgttaattggtctgatgtttagcagtagcaccacaatactaataattaataataacaacaataatagtatggaaggataaaaaaaaaaaaaaactgtctcattatctcatgccgttgtaattataacatctgcttgcattttttttct

//