2024-03-29 14:43:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_010240748 687 bp mRNA linear PLN 27-MAR-2018 DEFINITION PREDICTED: Brachypodium distachyon uncharacterized protein At4g02000 (LOC104584924), mRNA. ACCESSION XM_010240748 VERSION XM_010240748.1 DBLINK BioProject: PRJNA74771 KEYWORDS RefSeq; includes ab initio. SOURCE Brachypodium distachyon (stiff brome) ORGANISM Brachypodium distachyon Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Stipodae; Brachypodieae; Brachypodium. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_016134.3) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Brachypodium distachyon Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..687 /organism="Brachypodium distachyon" /mol_type="mRNA" /strain="Bd21" /db_xref="taxon:15368" /chromosome="4" gene 1..687 /gene="LOC104584924" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:104584924" CDS 1..687 /gene="LOC104584924" /codon_start=1 /product="uncharacterized protein At4g02000" /protein_id="XP_010239050.1" /db_xref="GeneID:104584924" /translation="
MGKNVVQGKGDGDLEKAMKNLAFREGELDVVVIEQADAEEMEKEFRWLALARVHTPRPFSVTGFKETMRSIWSLVHDADCREVDDNLFLIRFFCLDNWKKVMNQGPWLFRGFMVVIHEYDGLSDKASIPFNHTAIWEQIHSIPDLYWRESVCDQLARRIGRVLSVEMNPPKYYEGDYIRVRASIDVREPLIRCVPLKLPKERLLLDVRYEKVGFFCDVCGLFGHTSEE"
misc_feature 109..543 /gene="LOC104584924" /note="Domain of unknown function (DUF4283); Region: DUF4283; pfam14111" /db_xref="CDD:433725" misc_feature 550..672 /gene="LOC104584924" /note="Zinc knuckle; Region: zf-CCHC_4; pfam14392" /db_xref="CDD:433930" ORIGIN
atggggaagaacgtggtgcaggggaaaggtgatggagatcttgagaaggcgatgaagaatcttgccttccgggagggtgagcttgatgttgttgtgatagagcaagcggatgcggaggagatggagaaggagttcagatggctggcgctcgcacgggtgcacacgccgcgaccttttagtgtgacgggtttcaaggaaaccatgagatcgatctggagtttggtgcatgatgcagactgccgagaggtggatgacaatctcttcttgatcagattcttctgcctagacaattggaagaaggtgatgaaccaaggtccatggttatttcgtggcttcatggtggtgattcatgaatatgatggtttgtccgacaaagcaagtatacctttcaaccacacggccatatgggagcaaatccactcaatcccggatctgtactggcgggaatcggtctgtgatcagctagcccgaaggattggcagggtgcttagtgttgagatgaatcctccgaagtactatgaaggggattacatcagggtgagggccagcatcgatgttcgtgagcccttgattagatgtgttccgctgaagctcccaaaggaacgcttgctgctggatgtacgctatgagaaggttggcttcttttgtgatgtttgtggcctttttggtcacacctcagaggagtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]