GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 14:43:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_010240748             687 bp    mRNA    linear   PLN 27-MAR-2018
DEFINITION  PREDICTED: Brachypodium distachyon uncharacterized protein
            At4g02000 (LOC104584924), mRNA.
ACCESSION   XM_010240748
VERSION     XM_010240748.1
DBLINK      BioProject: PRJNA74771
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Brachypodium distachyon (stiff brome)
  ORGANISM  Brachypodium distachyon
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP
            clade; Pooideae; Stipodae; Brachypodieae; Brachypodium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_016134.3) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Brachypodium distachyon Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..687
                     /organism="Brachypodium distachyon"
                     /mol_type="mRNA"
                     /strain="Bd21"
                     /db_xref="taxon:15368"
                     /chromosome="4"
     gene            1..687
                     /gene="LOC104584924"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:104584924"
     CDS             1..687
                     /gene="LOC104584924"
                     /codon_start=1
                     /product="uncharacterized protein At4g02000"
                     /protein_id="XP_010239050.1"
                     /db_xref="GeneID:104584924"
                     /translation="
MGKNVVQGKGDGDLEKAMKNLAFREGELDVVVIEQADAEEMEKEFRWLALARVHTPRPFSVTGFKETMRSIWSLVHDADCREVDDNLFLIRFFCLDNWKKVMNQGPWLFRGFMVVIHEYDGLSDKASIPFNHTAIWEQIHSIPDLYWRESVCDQLARRIGRVLSVEMNPPKYYEGDYIRVRASIDVREPLIRCVPLKLPKERLLLDVRYEKVGFFCDVCGLFGHTSEE"
     misc_feature    109..543
                     /gene="LOC104584924"
                     /note="Domain of unknown function (DUF4283); Region:
                     DUF4283; pfam14111"
                     /db_xref="CDD:433725"
     misc_feature    550..672
                     /gene="LOC104584924"
                     /note="Zinc knuckle; Region: zf-CCHC_4; pfam14392"
                     /db_xref="CDD:433930"
ORIGIN      
atggggaagaacgtggtgcaggggaaaggtgatggagatcttgagaaggcgatgaagaatcttgccttccgggagggtgagcttgatgttgttgtgatagagcaagcggatgcggaggagatggagaaggagttcagatggctggcgctcgcacgggtgcacacgccgcgaccttttagtgtgacgggtttcaaggaaaccatgagatcgatctggagtttggtgcatgatgcagactgccgagaggtggatgacaatctcttcttgatcagattcttctgcctagacaattggaagaaggtgatgaaccaaggtccatggttatttcgtggcttcatggtggtgattcatgaatatgatggtttgtccgacaaagcaagtatacctttcaaccacacggccatatgggagcaaatccactcaatcccggatctgtactggcgggaatcggtctgtgatcagctagcccgaaggattggcagggtgcttagtgttgagatgaatcctccgaagtactatgaaggggattacatcagggtgagggccagcatcgatgttcgtgagcccttgattagatgtgttccgctgaagctcccaaaggaacgcttgctgctggatgtacgctatgagaaggttggcttcttttgtgatgtttgtggcctttttggtcacacctcagaggagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]