2024-04-29 10:44:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009080671 1447 bp mRNA linear VRT 05-SEP-2014 DEFINITION PREDICTED: Acanthisitta chloris vimentin (VIM), partial mRNA. ACCESSION XM_009080671 VERSION XM_009080671.1 DBLINK BioProject: PRJNA253841 KEYWORDS RefSeq. SOURCE Acanthisitta chloris (rifleman) ORGANISM Acanthisitta chloris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Passeriformes; Acanthisittidae; Acanthisitta. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_008687599.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Acanthisitta chloris Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..1447 /organism="Acanthisitta chloris" /mol_type="mRNA" /isolate="BGI_N310" /db_xref="taxon:57068" /chromosome="Unknown" /sex="female" /country="New Zealand" gene <1..1447 /gene="VIM" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 172 ESTs, 61 Proteins" /db_xref="GeneID:103807920" CDS <1..867 /gene="VIM" /codon_start=1 /product="vimentin" /protein_id="XP_009078919.1" /db_xref="GeneID:103807920" /translation="
PPHRCLAPSRLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIVFLKKLHDEEIRELQAQLQEQHIQIDMDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQEANEYRRQIQSLTCEVDALKGSNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRINMPIPTFASLNLRETNIESQPMVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE"
misc_feature <28..696 /gene="VIM" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:425436" ORIGIN
cctcctcaccgctgtcttgccccttccaggttgcaagaggagatgcttcagagggaggaggccgagaacaccctgcagtccttccgacaggatgttgacaatgcctctctggcacgtcttgatcttgagcggaaagttgagtccctgcaagaggagatcgtcttcttgaagaagcttcatgatgaggaaatccgagaactgcaggcccaactgcaggaacagcacatccaaattgatatggatgtttctaagcctgatcttactgctgccctgcgtgatgttcgccagcagtatgaaagcgttgctgctaagaatcttcaggaagctgaagagtggtacaagtccaaatttgcagatctctccgaagctgctaataggaacaacgatgccctgcgccaggccaaacaggaagctaatgagtaccgcagacagattcagtctctcacctgcgaagttgatgctcttaagggaagcaatgagtccctggagcgccagatgcgtgaaatggaggagaattttgctgttgaagctgctaactaccaagacactattggccgcctgcaggacgagattcagaacatgaaggaagaaatggctcgccacctgcgcgagtaccaggacctgctgaatgtaaagatggctcttgatattgagattgccacctacagaaaactgttggagggtgaagagagcaggattaacatgcctattccaacctttgcttctttgaacctgagagaaaccaacattgagtctcagccaatggttgacactcactcaaagaggacacttctaattaagactgtcgaaactagagatggacaggttattaatgaaacttcccagcatcatgatgacttggagtaaagctgaagtgaagatgcatacttactaatgcaggagaaattcttaccagcaagattgaaaaagtccatgtcttaaaggaagaaacagctttcaagtgcctttctgcagtttttccatgagcgcaagatgattatgctaggaaataggtcttagatcttgcaaactgactctccctgaaggattagagtttacaatggagtctagtttacaaatagcaatatcttgtgctgcaatactgtttttaagtatctgaattcaataaaactgcttttttccagcacagtatgagcaacctgtcgctacttcaataaatctttggaaaatggctcttgatgtgttttaatttgttaacttcatgactttctggaaagccataacaacataatgctggaattactatacggttgacatctctagtactggctgtgtggaatgctgttttttcagtttaactagataaactgtcttgctcatttactgcttaggttttggaaccaactaaaatggactataactggcagatgcataatgtattatgatctttcttatcacttgaataaaatatgatacttcaagctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]