LOCUS       XM_008482525            1022 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Diaphorina citri multiple inositol polyphosphate
            phosphatase 1-like (LOC103517490), mRNA.
ACCESSION   XM_008482525
VERSION     XM_008482525.3
DBLINK      BioProject: PRJNA251515
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Diaphorina citri (Asian citrus psyllid)
  ORGANISM  Diaphorina citri
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha;
            Psylloidea; Psyllidae; Diaphorininae; Diaphorina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_007379292.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_008482525.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Diaphorina citri Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1022
                     /organism="Diaphorina citri"
                     /mol_type="mRNA"
                     /db_xref="taxon:121845"
                     /chromosome="Unknown"
                     /collection_date="2010"
     gene            1..1022
                     /gene="LOC103517490"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 95% coverage of the annotated
                     genomic feature by RNAseq alignments, including 11 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:103517490"
     CDS             189..1022
                     /gene="LOC103517490"
                     /codon_start=1
                     /product="multiple inositol polyphosphate phosphatase
                     1-like"
                     /protein_id="XP_008480747.2"
                     /db_xref="GeneID:103517490"
                     /translation="

MFRPSLPLTLAALLVILPAVLSQPAPDDYNCYAEDEYPYLFFSSKTAYQYIYDKKPQVIPHCKPVQIWTVARHGTRYPSKKEIIRMKDLVNLQSEVMKNYERRDIERKLCEKDLTNLRKWVYNLTLDLDYQLAPQGHDDLFYLAKRMRTKFPILNDAAGFSPEQIQSHFLIRHTQTPRTKESAEAFVEGLFGGRASSIIPPGQDNEMLIKPYINCTPWEQAVDDEIHTREATLFEEGPLMKGLIASVSRRLGFTYNLTLGEIFTRSIFFEQTRTKLH"

     misc_feature    381..>980
                     /gene="LOC103517490"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:448243"
ORIGIN      

tttgtgaggagatctcgtcgagttactttcggctgaacagtataatattttttcggagatttttatttttcgtcgcgatgttcttgtgggtgtagatttgtgtgcacttttgtgacagctttcttttgcagccctccgtccgaagaggctcagtagtgtggattttgacatctttgacccccatcgccatgtttcgcccctcgctccccctgaccttagccgcccttctggtgatcctaccggcagttctatctcaacccgcaccggatgactataactgctacgccgaagacgagtacccctatctgtttttctcatctaagaccgcctaccagtatatctacgataagaaaccacaagtgattccgcattgcaaaccggttcaaatatggacggtagcacgccatggtacccgatatccaagcaagaaggagataataaggatgaaggatttggtcaacctgcaatctgaggttatgaagaactacgagcgacgtgatatcgagaggaagctgtgcgagaaggacctgaccaacctgaggaagtgggtgtacaacctgaccctcgaccttgactatcagctggcgcctcaaggtcacgatgaccttttctatctggccaagagaatgaggaccaagtttccaattctgaatgatgcggctgggttttcaccagaacaaattcagagtcatttcctgatccgtcacactcagacccccaggacgaaagagagcgccgaagcatttgtagaggggctattcggaggtagagcctcctctatcatccctccgggacaggacaatgagatgctcatcaagccgtacattaattgtaccccatgggaacaggcagtggacgacgaaatccacacgagagaggcgaccctatttgaagaaggcccactcatgaaagggttaatcgccagcgtgagtcggcggctgggattcacgtacaacttaacccttggtgagatttttacccgatcaatattttttgaacaaaccagaacaaaactacattaa

//