2024-04-25 09:50:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_008482525 1022 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Diaphorina citri multiple inositol polyphosphate phosphatase 1-like (LOC103517490), mRNA. ACCESSION XM_008482525 VERSION XM_008482525.3 DBLINK BioProject: PRJNA251515 KEYWORDS RefSeq; includes ab initio. SOURCE Diaphorina citri (Asian citrus psyllid) ORGANISM Diaphorina citri Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Psylloidea; Psyllidae; Diaphorininae; Diaphorina. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007379292.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_008482525.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Diaphorina citri Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 5% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1022 /organism="Diaphorina citri" /mol_type="mRNA" /db_xref="taxon:121845" /chromosome="Unknown" /collection_date="2010" gene 1..1022 /gene="LOC103517490" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 95% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns" /db_xref="GeneID:103517490" CDS 189..1022 /gene="LOC103517490" /codon_start=1 /product="multiple inositol polyphosphate phosphatase 1-like" /protein_id="XP_008480747.2" /db_xref="GeneID:103517490" /translation="
MFRPSLPLTLAALLVILPAVLSQPAPDDYNCYAEDEYPYLFFSSKTAYQYIYDKKPQVIPHCKPVQIWTVARHGTRYPSKKEIIRMKDLVNLQSEVMKNYERRDIERKLCEKDLTNLRKWVYNLTLDLDYQLAPQGHDDLFYLAKRMRTKFPILNDAAGFSPEQIQSHFLIRHTQTPRTKESAEAFVEGLFGGRASSIIPPGQDNEMLIKPYINCTPWEQAVDDEIHTREATLFEEGPLMKGLIASVSRRLGFTYNLTLGEIFTRSIFFEQTRTKLH"
misc_feature 381..>980 /gene="LOC103517490" /note="Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP; cl11399" /db_xref="CDD:448243" ORIGIN
tttgtgaggagatctcgtcgagttactttcggctgaacagtataatattttttcggagatttttatttttcgtcgcgatgttcttgtgggtgtagatttgtgtgcacttttgtgacagctttcttttgcagccctccgtccgaagaggctcagtagtgtggattttgacatctttgacccccatcgccatgtttcgcccctcgctccccctgaccttagccgcccttctggtgatcctaccggcagttctatctcaacccgcaccggatgactataactgctacgccgaagacgagtacccctatctgtttttctcatctaagaccgcctaccagtatatctacgataagaaaccacaagtgattccgcattgcaaaccggttcaaatatggacggtagcacgccatggtacccgatatccaagcaagaaggagataataaggatgaaggatttggtcaacctgcaatctgaggttatgaagaactacgagcgacgtgatatcgagaggaagctgtgcgagaaggacctgaccaacctgaggaagtgggtgtacaacctgaccctcgaccttgactatcagctggcgcctcaaggtcacgatgaccttttctatctggccaagagaatgaggaccaagtttccaattctgaatgatgcggctgggttttcaccagaacaaattcagagtcatttcctgatccgtcacactcagacccccaggacgaaagagagcgccgaagcatttgtagaggggctattcggaggtagagcctcctctatcatccctccgggacaggacaatgagatgctcatcaagccgtacattaattgtaccccatgggaacaggcagtggacgacgaaatccacacgagagaggcgaccctatttgaagaaggcccactcatgaaagggttaatcgccagcgtgagtcggcggctgggattcacgtacaacttaacccttggtgagatttttacccgatcaatattttttgaacaaaccagaacaaaactacattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]