GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 17:51:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_205137               1111 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus NK2 homeobox 6 (NKX2-6), mRNA.
ACCESSION   NM_205137 XM_444649
VERSION     NM_205137.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1111)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1111)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1111)
  AUTHORS   Tanaka M, Kasahara H, Bartunkova S, Schinke M, Komuro I, Inagaki H,
            Lee Y, Lyons GE and Izumo S.
  TITLE     Vertebrate homologs of tinman and bagpipe: roles of the homeobox
            genes in cardiovascular development
  JOURNAL   Dev Genet 22 (3), 239-249 (1998)
   PUBMED   9621431
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from Y10655.1.
            
            On Aug 30, 2004 this sequence version replaced XM_444649.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y10655.1, SRR13267650.32988.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992527, SAMEA2812691
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1111
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="22"
                     /map="22"
     gene            1..1111
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /note="NK2 homeobox 6"
                     /db_xref="CGNC:49622"
                     /db_xref="GeneID:396037"
     exon            1..143
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /inference="alignment:Splign:2.1.0"
     CDS             32..613
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /note="homeobox protein Nkx-2.8; NK2 transcription factor
                     related, locus 6"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.6"
                     /protein_id="NP_990468.1"
                     /db_xref="CGNC:49622"
                     /db_xref="GeneID:396037"
                     /translation="
MLPTPFSVEDILSLEQSSAPGAPGVRRSPSVEEEPPSGQCLLSQPLQADQQQTDPCHHPKQPQRRKPRVLFSQTQVLELERRFKQQKYLSALEREHLANVLQLTSTQVKIWFQNRRYKCKRQRQDRSLEMATYPLPPRKVAVPVLVRNGKPCFEGSQPHLAPYGITVSPYSYSTYYSAYGVSYGVGYTGVLTP"
     misc_feature    221..391
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(224..238,242..244,293..295,311..313,350..352,
                     356..361,368..373,377..385,389..394)
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(230..232,239..241,359..361,368..373,380..382)
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            144..1042
                     /gene="NKX2-6"
                     /gene_synonym="NKX2.8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cagggagctcacaccgatccccccccggaggatgctgcccacccctttctccgtcgaggatatcctcagcctggagcagagcagcgctcccggagcccccggggtccgccgcagcccttccgtggaggaggaaccgccgtcgggacaatgtctgctctcccagcccttgcaggcagaccagcagcaaactgacccctgccaccaccccaagcaaccgcagcggcgcaaaccccgcgttttgttctcccaaactcaggtgttggagttggagcggcgattcaagcagcagaaatacctctctgcactggaaagggaacacctggccaacgtgctccagctcacctccacccaggtgaaaatctggttccagaaccggcgctacaaatgcaagaggcagaggcaggatagatccctggagatggccacctacccactgccaccacgtaaagtggctgttccggtgctggtcagaaatggcaagccttgctttgaggggtcccaaccccacctggctccttatgggatcaccgtcagcccctactcctatagcacctactacagtgcctacggggtgagctatggggtgggatatactggggtgctcacaccatgagcttgggctcagcaccagttgagatgtggcccaggaaagggatgggggcatccggagtcgtaatggacagcaggtggtgcgtccaacctcaccaaccagcccaaggaaagggacttctggtgctgcggatttggggacctcagtgcaggggcatttatttatttgggcacaaacatggagtccatcccatctcaccccatagggatggtcctgtgggatgcatagggatgggatgctgctcttcttcctaaggaaacagggtctgtgcacaccactgcgcctttgcttttccatgaacactctatttaaggctttgagttcctctcatcttttgggatattcatatttcttaatgacttaaaagcacaggtgttcgtttctgtcttggttattgttattatttgcaattaaaaaaaaataaggtgggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]