LOCUS       NM_204911                818 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus homeobox B8 (HOXB8), mRNA.
ACCESSION   NM_204911 XM_429258
VERSION     NM_204911.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 818)
  AUTHORS   Yang KX, Zhou H, Ding JM, He C, Niu Q, Gu CJ, Zhou ZX, Meng H and
            Huang QZ.
  TITLE     Copy number variation in HOXB7 and HOXB8 involves in the formation
            of beard trait in chickens
  JOURNAL   Anim Genet 51 (6), 958-963 (2020)
   PUBMED   33058257
  REMARK    GeneRIF: Copy number variation in HOXB7 and HOXB8 involves in the
            formation of beard trait in chickens.
REFERENCE   2  (bases 1 to 818)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   3  (bases 1 to 818)
  AUTHORS   Guo Y, Gu X, Sheng Z, Wang Y, Luo C, Liu R, Qu H, Shu D, Wen J,
            Crooijmans RP, Carlborg O, Zhao Y, Hu X and Li N.
  TITLE     A Complex Structural Variation on Chromosome 27 Leads to the
            Ectopic Expression of HOXB8 and the Muffs and Beard Phenotype in
            Chickens
  JOURNAL   PLoS Genet 12 (6), e1006071 (2016)
   PUBMED   27253709
  REMARK    GeneRIF: The results strongly suggest the Mb allele leading to the
            Muffs and beard phenotype in chickens leads to an altered ectopic
            expression of a homeotic gene HOXB8, to suggest a novel role for
            HOXB8 in modulating the regional development of the feather.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 818)
  AUTHORS   Huber L, Ferdin M, Holzmann J, Stubbusch J and Rohrer H.
  TITLE     HoxB8 in noradrenergic specification and differentiation of the
            autonomic nervous system
  JOURNAL   Dev Biol 363 (1), 219-233 (2012)
   PUBMED   22236961
  REMARK    GeneRIF: Data suggest that HoxB8 acts by maintaining noradrenergic
            properties transiently expressed in ciliary neuron progenitors
            during normal development.
REFERENCE   5  (bases 1 to 818)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 818)
  AUTHORS   Scotting PJ, Hewitt M and Keynes RJ.
  TITLE     Isolation and analysis of chick homeobox cDNA clones
  JOURNAL   Nucleic Acids Res 18 (13), 3999 (1990)
   PUBMED   1973835
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            U81801.1.
            
            On Mar 26, 2015 this sequence version replaced NM_204911.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U81801.1, SRR13267649.255815.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-818               U81801.1           11-828
FEATURES             Location/Qualifiers
     source          1..818
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="27"
                     /map="27"
                     /breed="Leghorn"
     gene            1..818
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="homeobox B8"
                     /db_xref="CGNC:66213"
                     /db_xref="GeneID:395737"
     exon            1..462
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    33..35
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="upstream in-frame stop codon"
     CDS             42..767
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="homeo box B8; Homeobox protein Hox-2.4"
                     /codon_start=1
                     /product="homeobox protein Hox-B8"
                     /protein_id="NP_990242.1"
                     /db_xref="CGNC:66213"
                     /db_xref="GeneID:395737"
                     /translation="

MSSYFVNSLFSKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGPSTGGTFQHPTQIQEFYHGASSLSSSPYQQNPCAVACHGDPSNFYGYDPLQRQSLFSAQESDLVQYTDCKLAASGLGEEAESSEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKMERAQEVDEEGEAQKADKK"

     misc_feature    order(474..488,492..494,543..545,561..563,600..602,
                     606..611,618..623,627..635,639..644)
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(480..482,489..491,609..611,618..623,630..632)
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    483..641
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            463..818
                     /gene="HOXB8"
                     /gene_synonym="CHOX-2.4; Hoxb-8; OX2.4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ttttcctcctcctccgtacaaatattattatttaaattaagatgagctcctattttgtcaactcactcttctccaaatacaaaaccggggactcgttgcgtcccaattactatgactgcgggttcgctcaggatcttgggggcagacccacggtggtgtacggacccagcacggggggcaccttccagcatccgacccaaatccaggagttctaccacggagcatcctcactctccagctccccttaccaacagaatccctgcgccgtggcgtgccatggggacccgagcaacttctatggctacgaccctttgcaaaggcagagcctcttcagcgcccaggagtcggacttggtgcagtacacggactgcaagcttgctgccagcggccttggagaggaggcggagagctcggagcagagcccttctccgacccagcttttcccctggatgcgaccgcaagccgctggacggaggagggggaggcaaacctacagccgctaccagacgctggaactggagaaggaatttctatttaatccctacctgacccgcaaacggaggatcgaggtctcgcatgccctgggattgacagaaaggcaggtcaaaatctggttccagaacaggaggatgaaatggaaaaaggaaaacaacaaagacaagtttcccagcagcaaatgcgagcaggaagaactggaaaaacagaaaatggaaagagcccaggaggtggacgaggaaggggaagcacagaaggcggacaagaaataaaaaggagttttgaggactgaaaggagagcgctgctggggtagagagccccc

//