ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-10-06 22:53:41, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_204674 2256 bp mRNA linear VRT 24-SEP-2023
DEFINITION Gallus gallus fibroblast growth factor 19 (FGF19), mRNA.
ACCESSION NM_204674
VERSION NM_204674.3
KEYWORDS RefSeq.
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
Phasianidae; Phasianinae; Gallus.
REFERENCE 1 (bases 1 to 2256)
AUTHORS Tang H, Finn RD and Thomas PD.
TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with
Gene Ontology terms and other annotations
JOURNAL Bioinformatics 35 (3), 518-520 (2019)
PUBMED 30032202
REFERENCE 2 (bases 1 to 2256)
AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
TITLE Manual GO annotation of predictive protein signatures: the InterPro
approach to GO curation
JOURNAL Database (Oxford) 2012, bar068 (2012)
PUBMED 22301074
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2256)
AUTHORS Okamoto M, Bito T, Noji S and Ohuchi H.
TITLE Subtype-specific expression of Fgf19 during horizontal cell
development of the chicken retina
JOURNAL Gene Expr Patterns 9 (5), 306-313 (2009)
PUBMED 19272464
REMARK GeneRIF: Results suggest that Fgf19 is expressed by the early
migratory horizontal precursors, and later by the presumptive
axon-bearing HCs.
REFERENCE 4 (bases 1 to 2256)
AUTHORS Okamoto M, Tomonari S, Naito Y, Saigo K, Noji S, Ui-Tei K and
Ohuchi H.
TITLE Introduction of silencing-inducing transgene against Fgf19 does not
affect expression of Tbx5 and beta3-tubulin in the developing
chicken retina
JOURNAL Dev Growth Differ 50 (3), 159-168 (2008)
PUBMED 18312426
REMARK GeneRIF: Fgf19 is not required for expression of dorso-ventral
morphogenetic genes in the eye
REFERENCE 5 (bases 1 to 2256)
AUTHORS Gimeno L and Martinez S.
TITLE Expression of chick Fgf19 and mouse Fgf15 orthologs is regulated in
the developing brain by Fgf8 and Shh
JOURNAL Dev Dyn 236 (8), 2285-2297 (2007)
PUBMED 17654705
REMARK GeneRIF: Fgf19 presents an expression in the isthmic alar plate,
diencephalic and mesencephalic parabasal plates, hindbrain basal
plate, as well as in the zona limitans intrathalamica (zli).
REFERENCE 6 (bases 1 to 2256)
AUTHORS Sanchez-Calderon H, Francisco-Morcillo J, Martin-Partido G and
Hidalgo-Sanchez M.
TITLE Fgf19 expression patterns in the developing chick inner ear
JOURNAL Gene Expr Patterns 7 (1-2), 30-38 (2007)
PUBMED 16798106
REMARK GeneRIF: detailed spatial and temporal patterns of Fgf19 expression
in the developing inner ear from otic cup (stage 14) to 8 embryonic
days (stage 34)
REFERENCE 7 (bases 1 to 2256)
AUTHORS Francisco-Morcillo J, Sanchez-Calderon H, Kawakami Y, Izpisua
Belmonte JC, Hidalgo-Sanchez M and Martin-Partido G.
TITLE Expression of Fgf19 in the developing chick eye
JOURNAL Brain Res Dev Brain Res 156 (1), 104-109 (2005)
PUBMED 15862633
REMARK GeneRIF: Fgf19 was expressed in a transient manner in postmitotic
neuroblasts during the migration from the ventricular surface to
their final location. and in retina not detected at p30.
REFERENCE 8 (bases 1 to 2256)
AUTHORS Kurose H, Bito T, Adachi T, Shimizu M, Noji S and Ohuchi H.
TITLE Expression of Fibroblast growth factor 19 (Fgf19) during chicken
embryogenesis and eye development, compared with Fgf15 expression
in the mouse
JOURNAL Gene Expr Patterns 4 (6), 687-693 (2004)
PUBMED 15465490
REMARK GeneRIF: Fgf19 is expressed in the developing chicken retina
REFERENCE 9 (bases 1 to 2256)
AUTHORS Ladher RK, Anakwe KU, Gurney AL, Schoenwolf GC and Francis-West PH.
TITLE Identification of synergistic signals initiating inner ear
development
JOURNAL Science 290 (5498), 1965-1967 (2000)
PUBMED 11110663
REMARK GeneRIF: Induces the inner ear
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
JAENSK010000214.1.
On Nov 8, 2021 this sequence version replaced NM_204674.2.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: AF315355.1, BU122912.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN03376184 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-358 JAENSK010000214.1 11146909-11147266 c
359-462 JAENSK010000214.1 11146701-11146804 c
463-2256 JAENSK010000214.1 11142347-11144140 c
FEATURES Location/Qualifiers
source 1..2256
/organism="Gallus gallus"
/mol_type="mRNA"
/db_xref="taxon:9031"
/chromosome="5"
/map="5"
gene 1..2256
/gene="FGF19"
/gene_synonym="FGF-19"
/note="fibroblast growth factor 19"
/db_xref="CGNC:66203"
/db_xref="GeneID:395394"
exon 1..358
/gene="FGF19"
/gene_synonym="FGF-19"
/inference="alignment:Splign:2.1.0"
CDS 121..795
/gene="FGF19"
/gene_synonym="FGF-19"
/codon_start=1
/product="fibroblast growth factor 19 precursor"
/protein_id="NP_990005.2"
/db_xref="CGNC:66203"
/db_xref="GeneID:395394"
/translation="
MGPRPAAPGAALALLGIAAAAAAARSLPLPDAGPHVNYGWGEPIRLRHLYTASKHGLFSCFLRIGGDGRVDAVGSQSPQSLLEIRAVAVRTVAIKGVQSSRYLCMDEAGRLHGQLSYSIEDCSFEEEIRPDGYNVYKSKKYGISVSLSSAKQRQQFKGKDFLPLSHFLPMINTVPVEVTDFGEYGDYSQAFEPEVYSSPLETDSMDPFGITSKLSPVKSPSFQK"
sig_peptide 121..189
/gene="FGF19"
/gene_synonym="FGF-19"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 250..633
/gene="FGF19"
/gene_synonym="FGF-19"
/note="FGF domain, beta-trefoil fold, found in fibroblast
growth factor 19 (FGF19) and similar proteins; Region:
beta-trefoil_FGF19; cd23331"
/db_xref="CDD:467017"
misc_feature order(250..261,367..369,502..504,622..633)
/gene="FGF19"
/gene_synonym="FGF-19"
/note="trimer interface [polypeptide binding]; other site"
/db_xref="CDD:467017"
exon 359..462
/gene="FGF19"
/gene_synonym="FGF-19"
/inference="alignment:Splign:2.1.0"
exon 463..2256
/gene="FGF19"
/gene_synonym="FGF-19"
/inference="alignment:Splign:2.1.0"
ORIGIN
acaccgccagccgcacagagcgcccaaccccgtatcgcaccgcaccgccccgcaccgcccgcggcaacgccgccgcccgacccgagcccgagcccgagtctgagtccgaggccgccgcggatggggccgcgccccgctgcacccggcgctgccctggcgctgctggggatcgccgccgccgccgccgccgccaggtccctgccgctgcccgacgcgggtccgcacgtcaactacggctggggggaacccatccggctgcggcacctctacaccgccagcaagcacgggctcttcagctgcttcctgcgcattggcggcgacggccgggtggacgctgtcggtagccagagcccgcagagtctgttggagatccgcgccgtggcggtgcgcaccgtggccatcaagggcgtgcagagctcccgctacctctgcatggacgaggcggggcggctgcacgggcagctcagctattccattgaggactgttcctttgaagaggagattcgtccagacggctacaacgtgtataaatcaaagaaatacgggatatcggtgtctttgagcagtgccaaacaaagacagcaattcaaaggaaaagattttctcccgctgtctcacttcttacccatgatcaacactgtgccagtggaggtgacagactttggtgaatatggtgattacagccaggcttttgagccagaggtctactcatcgcctctcgaaacggacagcatggatccctttgggatcacttccaaactgtctccagtgaagagccccagctttcagaaatgactctgattgcacacgcggttttaaagagataccgcagaatgttgcaggtttttagcttcttgtgtagtgatgtctcaaacgtttttttcacgtctcagtatggagacggcatttcccgtacaatgtgttgtacctataagagctgagtgcccagttgccatattcgaaagaattgcctctccgtagtatacttggaaaagaaaaattaaataagagcagcttaacaaattcatcagagttcctccattactgtggtgatgataaaatacatagctttcgtacatcaaattcattaccacatatgttcacctgttgtttctgttcatatatataaatacaggaaatcttgccatccacagggaagttcacaaccttgtagacaaacatttggaacaaaacacagttaaggaagactgagcaagtgtggttatgtgaactaaagttagcgctgtttcttgaaaagctgctgacaaccttctgggaaggctttctgttgaaagcataccactgaaaaacaattctgctgatatattgtgctttttcttcccttaggaaagaggggaagagaggaaaatatttcttccttccccaactgctaagggataccttggaaaactggattttattttataggctaatttatgttcactacgggatcttcatcgtccagcatagacttgtctttaatgctaatgggaattcagcatgtgggtaggagtgtatacagaactagcatttgtgttcatctggtaggaatgagcagttcaaattagtgtccagatataggttctgctgtatatactcatgtacgttggtagcaaataggaagtctgaaaatggatgatgtgtaggtcacatcagttgcaaagaacatttctgtgttttgcctttaaccgccagcaattcttctaggtccacccaggcttcatcctgcaccgtttgaaaccgtggagatgcaatttagggactcaaacgctgcagaactgagctggccatgccgtggttcttgcagggagggatcgtgtggatctcatggccaaaaagcatgtctgatgtcttcagttctgttctccccttgtgacaatttaacaaaggaataaccaaagagaaaccaaaagaagacaaatgtaagggttcatccactcatttccaaaggctcgcttataatagagatttctatacaaaaagctctactgaaaacactggtgttcttctgacctagcacttcattgccaatgcaatatttataattaatttattaaatacatacctctgtttattttgttactgttatttatgctcaaaattctatttatatactcttgaaggtgggttttttggttgtaacaaattttgcgaagttttgtaatcattaaattgtaggaaacaatagctttttaaatctctgttcattattggtagtgtaatatgtacatttgcaataaaaaatcgtcttcagta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]