GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 09:11:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001397349             523 bp    mRNA    linear   PRI 03-MAY-2023
DEFINITION  Homo sapiens tetrapeptide repeat homeobox 2 (TPRX2), transcript
            variant 3, mRNA.
ACCESSION   NM_001397349
VERSION     NM_001397349.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 523)
  AUTHORS   Zou Z, Zhang C, Wang Q, Hou Z, Xiong Z, Kong F, Wang Q, Song J, Liu
            B, Liu B, Wang L, Lai F, Fan Q, Tao W, Zhao S, Ma X, Li M, Wu K,
            Zhao H, Chen ZJ and Xie W.
  TITLE     Translatome and transcriptome co-profiling reveals a role of TPRXs
            in human zygotic genome activation
  JOURNAL   Science 378 (6615), abo7923 (2022)
   PUBMED   36074823
REFERENCE   2  (bases 1 to 523)
  AUTHORS   Lewin TD, Royall AH and Holland PWH.
  TITLE     Dynamic Molecular Evolution of Mammalian Homeobox Genes:
            Duplication, Loss, Divergence and Gene Conversion Sculpt PRD Class
            Repertoires
  JOURNAL   J Mol Evol 89 (6), 396-414 (2021)
   PUBMED   34097121
REFERENCE   3  (bases 1 to 523)
  AUTHORS   Madissoon E, Jouhilahti EM, Vesterlund L, Tohonen V, Krjutskov K,
            Petropoulos S, Einarsdottir E, Linnarsson S, Lanner F, Mansson R,
            Hovatta O, Burglin TR, Katayama S and Kere J.
  TITLE     Characterization and target genes of nine human PRD-like homeobox
            domain genes expressed exclusively in early embryos
  JOURNAL   Sci Rep 6, 28995 (2016)
   PUBMED   27412763
  REMARK    Erratum:[Sci Rep. 2016 Sep 02;6:32053. PMID: 27586261]
            Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC024582.7.
            
            On Nov 10, 2021 this sequence version replaced NM_001397349.1.
            
            Summary: Homeobox genes encode DNA-binding proteins, many of which
            are thought to be involved in early embryonic development. Homeobox
            genes encode a DNA-binding domain of 60 to 63 amino acids referred
            to as the homeodomain. This pseudogene is a member of the TPRX
            homeobox gene family. [provided by RefSeq, Jul 2008].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: LN901408.1 [ECO:0000332]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                AC024582.7         19367-19403
            38-207              AC024582.7         20245-20414
            208-523             AC024582.7         21538-21853
FEATURES             Location/Qualifiers
     source          1..523
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.33"
     gene            1..523
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /note="tetrapeptide repeat homeobox 2"
                     /db_xref="GeneID:503627"
                     /db_xref="HGNC:HGNC:32175"
                     /db_xref="MIM:620360"
     exon            1..37
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1934280354"
     variation       3
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482869299"
     variation       6
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056287664"
     CDS             13..366
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /note="isoform 3 is encoded by transcript variant 3;
                     tetra-peptide repeat homeobox pseudogene 1; tetra-peptide
                     repeat homeobox 1 pseudogene; tetra-peptide repeat
                     homeobox 2 pseudogene; tetrapeptide repeat homeobox 2,
                     pseudogene; Tetrapeptide repeat homeobox protein 2"
                     /codon_start=1
                     /product="tetrapeptide repeat homeobox protein 2 isoform
                     3"
                     /protein_id="NP_001384278.1"
                     /db_xref="CCDS:CCDS92656.1"
                     /db_xref="GeneID:503627"
                     /db_xref="HGNC:HGNC:32175"
                     /db_xref="MIM:620360"
                     /translation="
MQDPGHLQGPPLALDPPRRQRQERTVYTESQQKVLEFYFQKDQYPNYDQRLNLAEMLSLREQQLQTGSRNPHSPPRRLSTKRRMASWTKITQSPGHYWIYRGPVPAKFFRSQRAWSG"
     misc_feature    82..>210
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cl00084"
                     /db_xref="CDD:444687"
     variation       13
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1040394497"
     variation       21
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:923230789"
     variation       25
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968360887"
     variation       26
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:929392277"
     variation       27
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1968360932"
     variation       30
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313499517"
     variation       36
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395997591"
     exon            38..207
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /inference="alignment:Splign:2.1.0"
     variation       38
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419921912"
     variation       46
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:960115363"
     variation       47
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409855878"
     variation       49
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2122121720"
     variation       50
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761883913"
     variation       52
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566697408"
     variation       54
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1394176466"
     variation       55
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568632406"
     variation       58
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:296397"
     variation       59
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968367805"
     variation       65..66
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1300297259"
     variation       68
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921814503"
     variation       70
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280593152"
     variation       73
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391623463"
     variation       74
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305585639"
     variation       82
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326543296"
     variation       83
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2122121732"
     variation       86
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1235040932"
     variation       88
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549442189"
     variation       92
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:913415014"
     variation       95
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219052125"
     variation       98
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234410866"
     variation       107
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:967927788"
     variation       116
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481044690"
     variation       118
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380149116"
     variation       127
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968368067"
     variation       128
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933257138"
     variation       130
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968368117"
     variation       133
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569281625"
     variation       134
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968368154"
     variation       139
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1460425195"
     variation       140
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249696781"
     variation       146
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1476255896"
     variation       148
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166244830"
     variation       153
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:891832577"
     variation       154
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:538234979"
     variation       156..157
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1428854041"
     variation       156
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968368300"
     variation       162
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1404117376"
     variation       166
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2122121755"
     variation       169
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1968368374"
     variation       169
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968368354"
     variation       173
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936356500"
     variation       174
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946133289"
     variation       175
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1355481783"
     variation       176
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1442471354"
     variation       179
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043496690"
     variation       182
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1307084079"
     variation       183
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1600013351"
     variation       184
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348057325"
     variation       187
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038717596"
     variation       189
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968368556"
     variation       190
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293400566"
     variation       191
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968368588"
     variation       195
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209339782"
     variation       196
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1354679153"
     variation       203
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1857691680"
     variation       206
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558223350"
     variation       207
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968368679"
     exon            208..523
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /inference="alignment:Splign:2.1.0"
     variation       209
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1454280527"
     variation       210
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219832618"
     variation       211
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767105051"
     variation       212
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310885904"
     variation       214
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233215841"
     variation       215
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752117308"
     variation       216
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755820526"
     variation       222
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:932733646"
     variation       224
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282672635"
     variation       226
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763603969"
     variation       228
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186946520"
     variation       231
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1347238898"
     variation       232
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1299893318"
     variation       235
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1859474379"
     variation       236
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540653977"
     variation       237
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187105191"
     variation       238
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:560412386"
     variation       239
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940191726"
     variation       241
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778672992"
     variation       242
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755073935"
     variation       244
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758303687"
     variation       246
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1161343264"
     variation       247
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968382770"
     variation       249
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389062467"
     variation       250
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781366998"
     variation       251
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748132164"
     variation       252
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968382873"
     variation       254
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968382895"
     variation       258
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770072375"
     variation       260
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:995678770"
     variation       262
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:902941924"
     variation       263
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437458694"
     variation       265
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968383061"
     variation       266
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968383080"
     variation       269
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749517483"
     variation       270
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771483113"
     variation       273
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230746225"
     variation       275
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2122122613"
     variation       281
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968383177"
     variation       283
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2122122622"
     variation       284
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1269279832"
     variation       285
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760159930"
     variation       288
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772416115"
     variation       290
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775087448"
     variation       291
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000006591"
     variation       294
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199201501"
     variation       296
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760044290"
     variation       298
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1476777955"
     variation       299
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763803040"
     variation       300
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412553531"
     variation       301
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:529598432"
     variation       302
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761439918"
     variation       303
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968383492"
     variation       306
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:543314120"
     variation       307
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1027285645"
     variation       309
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1968383583"
     variation       311
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323192057"
     variation       312..323
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="t"
                     /replace="tagggggcctgt"
                     /db_xref="dbSNP:1968383623"
     variation       313
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894117374"
     variation       314..324
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="gggggcctgtg"
                     /db_xref="dbSNP:1968383711"
     variation       314..318
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:769647162"
     variation       315
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765062240"
     variation       316
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1411690308"
     variation       318
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750182248"
     variation       320
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350336012"
     variation       322
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227164904"
     variation       324..325
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1968383876"
     variation       324
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758356746"
     variation       326
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1318061673"
     variation       327
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1357551004"
     variation       330
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1210032400"
     variation       331
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288650686"
     variation       334..335
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="tt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1489732977"
     variation       336
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752831097"
     variation       339
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206601256"
     variation       340..341
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1251910040"
     variation       343..344
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1472219771"
     variation       344
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562892999"
     variation       346
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968384129"
     variation       347
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1414982685"
     variation       352
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1179993303"
     variation       353
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968384207"
     variation       355..356
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:1369950110"
     variation       357
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777895412"
     variation       358
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968384285"
     variation       359..365
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="gtggctg"
                     /db_xref="dbSNP:1162459444"
     variation       359..361
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="gtg"
                     /db_xref="dbSNP:2122122753"
     variation       359
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388778298"
     variation       366
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1600015300"
     variation       368
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968384369"
     variation       373
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968384401"
     variation       374
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:977278269"
     variation       375
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031469653"
     variation       379
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968384500"
     variation       380
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1600015320"
     variation       381
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1024304252"
     variation       382
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1600015330"
     variation       397
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968384604"
     variation       399..405
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="catcacc"
                     /replace="catcaccatcacc"
                     /db_xref="dbSNP:1902154618"
     variation       402
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1600015334"
     variation       404..406
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="ccc"
                     /db_xref="dbSNP:971427390"
     variation       404..406
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:34083556"
     variation       406
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957282423"
     variation       410
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1600015348"
     variation       414
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1600015350"
     variation       415
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968384714"
     variation       418
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968384733"
     variation       422
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1015649399"
     variation       424
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761172856"
     variation       425
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2122122814"
     variation       428
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968384820"
     variation       429
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921282030"
     variation       430
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:974248325"
     variation       431
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254269236"
     variation       433
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531954121"
     variation       439
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968384925"
     variation       442
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188363254"
     variation       445
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968384968"
     variation       448
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1486232484"
     variation       451
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:551861811"
     variation       456
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968385026"
     variation       462
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968385052"
     variation       467
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1355716837"
     variation       468
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968385109"
     variation       472
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:987316806"
     variation       473
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274230274"
     variation       475
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1968385177"
     variation       478
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968385211"
     variation       479
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306674262"
     variation       480
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781316948"
     variation       482
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968385300"
     variation       483
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968385326"
     variation       486
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968385343"
     variation       488..490
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace=""
                     /replace="ctg"
                     /db_xref="dbSNP:1968385370"
     variation       492
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1415825750"
     variation       493
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968385415"
     variation       499
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1872773889"
     variation       504
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1295493588"
     variation       505
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777185927"
     variation       509
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1968385459"
     variation       511
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932909641"
     variation       512
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:987050038"
     variation       522
                     /gene="TPRX2"
                     /gene_synonym="TPRX2P; TPRX2P1; TPRXP1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:944344854"
ORIGIN      
tcaggactcaggatgcaagaccctggtcatctccaaggccctcccctggccctggaccctccaaggagacagcggcaggagcgcacggtctacactgaaagccagcagaaagtgctagaattttactttcagaaggaccagtacccgaactacgaccagcgactgaatctggcggagatgctcagcctcagggagcaacagctgcagaccggttcgaggaatcctcactctccaccacgacgtctcagtacaaagaggaggatggcttcgtggacaaaaatcactcagtccccaggtcattactggatttatagggggcctgtgcctgcaaagttcttcagatcccagagggcctggagtggctgatctacactgctggtgactttctgcagtgaatgcatcaccctttacccaccctgctgcaggtggacatttgctgtcttcactgtgcagccatcacaggtggctctgctgtgaatgtgcctgcctgtcatttgaattgagcctgagcgtttctctgctg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]