LOCUS       NM_001101947            1700 bp    mRNA    linear   MAM 03-FEB-2022
DEFINITION  Bos taurus caudal type homeobox 1 (CDX1), mRNA.
ACCESSION   NM_001101947 XM_589247
VERSION     NM_001101947.1
KEYWORDS    RefSeq.
SOURCE      Bos taurus (cattle)
  ORGANISM  Bos taurus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bos.
REFERENCE   1  (bases 1 to 1700)
  AUTHORS   Zimin AV, Delcher AL, Florea L, Kelley DR, Schatz MC, Puiu D,
            Hanrahan F, Pertea G, Van Tassell CP, Sonstegard TS, Marcais G,
            Roberts M, Subramanian P, Yorke JA and Salzberg SL.
  TITLE     A whole-genome assembly of the domestic cow, Bos taurus
  JOURNAL   Genome Biol 10 (4), R42 (2009)
   PUBMED   19393038
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC148005.1.
            
            On Aug 21, 2007 this sequence version replaced XM_589247.3.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC148005.1, SRR5571259.24881.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03145429, SAMN03145461
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1700
                     /organism="Bos taurus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9913"
                     /chromosome="7"
                     /map="7"
                     /breed="L1 Hereford"
     gene            1..1700
                     /gene="CDX1"
                     /note="caudal type homeobox 1"
                     /db_xref="BGD:BT11793"
                     /db_xref="GeneID:511830"
                     /db_xref="VGNC:VGNC:106683"
     exon            1..527
                     /gene="CDX1"
                     /inference="alignment:Splign:2.1.0"
     CDS             83..880
                     /gene="CDX1"
                     /codon_start=1
                     /product="homeobox protein CDX-1"
                     /protein_id="NP_001095417.1"
                     /db_xref="BGD:BT11793"
                     /db_xref="GeneID:511830"
                     /db_xref="VGNC:VGNC:106683"
                     /translation="

MYVGYVLDKDSPVYPGPARPASLSLGPQAYGPPPPPPGPPQYPDFTGYSHVEPGPVPPAAWSAPFSAPKDEWAAAYGPGPTAPTSSPAPLAFGPPPDFGAVPTPPGPGPGLLAQPLGGPGTPSSPGAQRRTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKQQQQQPPQPPPPAHDITSTPAGPPLGGLCPSSASLLGASSPVPVKEEYLP"

     misc_feature    119..508
                     /gene="CDX1"
                     /note="Caudal like protein activation region; Region:
                     Caudal_act; pfam04731"
                     /db_xref="CDD:428094"
     misc_feature    order(548..559,563..565,614..616,632..634,671..673,
                     677..682,689..694,698..706,710..715)
                     /gene="CDX1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(551..553,560..562,680..682,689..694,701..703)
                     /gene="CDX1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    554..712
                     /gene="CDX1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            528..673
                     /gene="CDX1"
                     /inference="alignment:Splign:2.1.0"
     exon            674..1678
                     /gene="CDX1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gttcaggtgtgcagtcgctcgtcggggcagccggctgcggcggctccagggcccagcatgcgcgggcggcctcgcggccaccatgtacgtgggctatgttctggacaaggattcccccgtgtaccccggccccgccaggcccgctagtctcagcctgggcccacaagcctacggccctccgcccccgccccctggacccccgcagtacccagatttcaccggctactctcacgtggagccgggccccgtgccccctgcagcctggagtgcgcccttctctgcgcccaaggacgaatgggctgccgcctacggcccgggccccacggctcccacctccagcccggccccgctggcattcgggccccctccggactttggcgcggtgcccacgcccccggggcctggcccgggtctcctggcgcagcccctcggcggcccaggcactccttcctcacccggagcgcaaaggcggacaccctacgagtggatgcggcgcagtgtggcggctggaggcggcggtggcagcggtaagactcggaccaaggacaaataccgggtggtctataccgaccaccagcgcctggagctggagaaggagttccactacagccgttacatcaccatccggcggaaatcagagctggccgccaacctggggctcactgaacggcaggtgaagatctggttccaaaaccggcgggccaaggagcgcaaagtgaataagaagcagcagcagcagcagcctccacagccacccccaccagcccatgacatcacctccaccccagcagggccacccctggggggcctgtgccccagctctgctagcctcctgggtgcctcctccccagtgcctgtcaaggaggaatatctgccatagccccctgaccagccttgtgggctgggggccttgaggactcaggtgctgggaatgtggctcctgtgggggcccaggagtctgagtcccaagccataccactgaccttctgagtaaccctggacaaatcacccacctattccctgcatcccctgggcccaaccgtgcagtgaacctgttgaataggaccttttcccactttggtgttctaggcctcagggggataagggtgcctggggtgggaagtcttaattcccaggaggcaaggtgaggaggatctagctcctcctccataggctcaaaggtgggaggctgttgtagggaccagactcctggagaaaggagatggaatccagggaagatggcttgcagaccatgacctgagggggtccaagggaagggtgccagcctgccttttcctgcaggctcacgtctacctgcccccatcatcacatgcctcgaaccctctccttgcaggatgcaaagtacaaagccctcaggattgagcctgggcaagagatgaccatcctgtctgagctacacagcatatcccctcacacccattctcagtggggtttccagattgtggggaggcccctgcaggggacacaggggcagagtctaccctaccaagtttctaccaccccaccaggctgtcccttggggaccacgcctcagagagcccccagaggactttctctgaaccaaacagacctcacaactgggcaagtgtgttgcacagagaatggaatctcttggatgcagcttcaagaataaactttttttttctctttttaaaaaaaaaaaaaaaaaaaaaaaaaaa

//