GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-24 06:40:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001100629             975 bp    mRNA    linear   VRT 16-SEP-2023
DEFINITION  Danio rerio taste receptor, type 2, member 202 (tas2r202), mRNA.
ACCESSION   NM_001100629 XM_001339344
VERSION     NM_001100629.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 975)
  AUTHORS   Kowatschew D and Korsching SI.
  TITLE     An Ancient Adenosine Receptor Gains Olfactory Function in Bony
            Vertebrates
  JOURNAL   Genome Biol Evol 13 (9) (2021)
   PUBMED   34499158
REFERENCE   2  (bases 1 to 975)
  AUTHORS   Wang S, Ji D, Yang Q, Li M, Ma Z, Zhang S and Li H.
  TITLE     NEFLb impairs early nervous system development via regulation of
            neuron apoptosis in zebrafish
  JOURNAL   J Cell Physiol 234 (7), 11208-11218 (2019)
   PUBMED   30569449
REFERENCE   3  (bases 1 to 975)
  AUTHORS   Pasquier J, Cabau C, Nguyen T, Jouanno E, Severac D, Braasch I,
            Journot L, Pontarotti P, Klopp C, Postlethwait JH, Guiguen Y and
            Bobe J.
  TITLE     Gene evolution and gene expression after whole genome duplication
            in fish: the PhyloFish database
  JOURNAL   BMC Genomics 17, 368 (2016)
   PUBMED   27189481
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 975)
  AUTHORS   Ohmoto M, Okada S, Nakamura S, Abe K and Matsumoto I.
  TITLE     Mutually exclusive expression of Galphaia and Galpha14 reveals
            diversification of taste receptor cells in zebrafish
  JOURNAL   J Comp Neurol 519 (8), 1616-1629 (2011)
   PUBMED   21452212
REFERENCE   5  (bases 1 to 975)
  AUTHORS   Oike H, Nagai T, Furuyama A, Okada S, Aihara Y, Ishimaru Y, Marui
            T, Matsumoto I, Misaka T and Abe K.
  TITLE     Characterization of ligands for fish taste receptors
  JOURNAL   J Neurosci 27 (21), 5584-5592 (2007)
   PUBMED   17522303
REFERENCE   6  (bases 1 to 975)
  AUTHORS   Ishimaru Y, Okada S, Naito H, Nagai T, Yasuoka A, Matsumoto I and
            Abe K.
  TITLE     Two families of candidate taste receptors in fishes
  JOURNAL   Mech Dev 122 (12), 1310-1321 (2005)
   PUBMED   16274966
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB290688.1.
            
            On Aug 8, 2007 this sequence version replaced XM_001339344.1.
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="8"
                     /map="8"
     gene            1..975
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="taste receptor, type 2, member 202"
                     /db_xref="GeneID:798975"
                     /db_xref="ZFIN:ZDB-GENE-070917-7"
     CDS             1..975
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="taste receptor, type 2, member 5; zfT2R5"
                     /codon_start=1
                     /product="taste receptor, type 2, member 202"
                     /protein_id="NP_001094099.1"
                     /db_xref="GeneID:798975"
                     /db_xref="ZFIN:ZDB-GENE-070917-7"
                     /translation="
MLSTQDKLVAWLLIGVLAILTIFFNMYLLLVNYRSYRKKHKLNPADFIITAIAIASISQQVLTYSWQTMDVIDTVCQISLVEAILLVLVFSVKLIIFWSTAFLTFYYGTKLVVEPVHCYTRIQEAIVKHVHIVLTVIVVSGFANCVPLLSVLTYYNGTTELGDCGSIMPSDTPGLVYVFYYVVISDIIPGIVMFKCSISISYHLAKHLLDMKASSNGTHGPKLGTQMRVIKMTLSLVFVYSCFVVVDIYTQTTVVLMRQNTLALIMLFASIYTTVSAFVLIYGKKSYWKELIASYNLFLDEYPCLNKMKVEEVKHEPHEHSHGH"
     misc_feature    34..720
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="rhodopsin receptor-like class A family of the
                     seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_classA_rhodopsin-like; cd00637"
                     /db_xref="CDD:410626"
     misc_feature    34..105
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410626"
     misc_feature    226..339
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410626"
     misc_feature    385..444
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410626"
     misc_feature    520..597
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410626"
     exon            1..975
                     /gene="tas2r202"
                     /gene_synonym="tas2r5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgctgtcgactcaagacaaactggtggcctggctgctgatcggcgtactggcgatcctgaccatcttcttcaacatgtatctgcttctagtcaactatagaagctacagaaaaaagcacaagctgaacccggcagacttcattattacagcaatcgccattgccagcatctcccagcaggtcctgacgtactcctggcagaccatggatgtgatcgacaccgtttgccaaatcagtctggtggaggccatattgttagtcctcgttttcagtgtgaagctcatcatattctggagcacggcctttctgactttttactatggcacgaaattagttgttgagcccgttcattgttacacaagaatccaagaagccattgtgaaacacgtccacattgtgttgacggtgatagttgtgagtggctttgcgaattgcgttcccttattgagtgtgttgacgtattacaatggcaccaccgaattgggcgattgtgggtctataatgccaagcgatacgcctgggcttgtctacgtcttctattacgttgtaatttctgacatcattccgggaatcgttatgttcaaatgcagcatttctatatcgtatcacttggcgaagcatcttctggacatgaaggcgagcagcaatggcactcacgggcctaaactcggcactcagatgcgggtgatcaagatgacgctcagtttggtgttcgtttacagctgttttgttgttgtggacatttacacgcagaccacggtggtgttgatgcggcagaacacactggctttgattatgctgttcgccagtatttacaccacagtcagtgcgttcgtgctgatttatgggaagaaaagctactggaaggagttgatcgcctcttataacctctttttagacgagtatccttgtttgaataaaatgaaggtcgaggaggtcaaacatgagccgcatgaacacagtcacgggcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]