2024-04-27 06:43:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001039830 963 bp mRNA linear VRT 17-DEC-2022 DEFINITION Danio rerio taste receptor, type 2, member 200, tandem duplicate 1 (tas2r200.1), mRNA. ACCESSION NM_001039830 VERSION NM_001039830.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 963) AUTHORS Behrens M, Di Pizio A, Redel U, Meyerhof W and Korsching SI. TITLE At the Root of T2R Gene Evolution: Recognition Profiles of Coelacanth and Zebrafish Bitter Receptors JOURNAL Genome Biol Evol 13 (1) (2021) PUBMED 33355666 REFERENCE 2 (bases 1 to 963) AUTHORS Ohmoto M, Okada S, Nakamura S, Abe K and Matsumoto I. TITLE Mutually exclusive expression of Galphaia and Galpha14 reveals diversification of taste receptor cells in zebrafish JOURNAL J Comp Neurol 519 (8), 1616-1629 (2011) PUBMED 21452212 REFERENCE 3 (bases 1 to 963) AUTHORS Oike H, Nagai T, Furuyama A, Okada S, Aihara Y, Ishimaru Y, Marui T, Matsumoto I, Misaka T and Abe K. TITLE Characterization of ligands for fish taste receptors JOURNAL J Neurosci 27 (21), 5584-5592 (2007) PUBMED 17522303 REFERENCE 4 (bases 1 to 963) AUTHORS Go Y. CONSRTM SMBE Tri-National Young Investigators TITLE Proceedings of the SMBE Tri-National Young Investigators' Workshop 2005. Lineage-specific expansions and contractions of the bitter taste receptor gene repertoire in vertebrates JOURNAL Mol Biol Evol 23 (5), 964-972 (2006) PUBMED 16484289 REFERENCE 5 (bases 1 to 963) AUTHORS Ishimaru Y, Okada S, Naito H, Nagai T, Yasuoka A, Matsumoto I and Abe K. TITLE Two families of candidate taste receptors in fishes JOURNAL Mech Dev 122 (12), 1310-1321 (2005) PUBMED 16274966 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB200903.1. ##Evidence-Data-START## Transcript exon combination :: AB200903.1 [ECO:0000332] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..963 /organism="Danio rerio" /mol_type="mRNA" /strain="Wako-Riken" /db_xref="taxon:7955" /chromosome="8" /map="8" gene 1..963 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="taste receptor, type 2, member 200, tandem duplicate 1" /db_xref="GeneID:664690" /db_xref="ZFIN:ZDB-GENE-070917-4" CDS 1..963 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="taste receptor, type 2, member 1a; bitter taste receptor; zfT2R1a; taste receptor, type 2, member 200.1" /codon_start=1 /product="taste receptor, type 2, member 200, tandem duplicate 1" /protein_id="NP_001034919.1" /db_xref="GeneID:664690" /db_xref="ZFIN:ZDB-GENE-070917-4" /translation="
MSTDVGNVLFFVGVGVVGVSGNIFNLIFSLQQQVKTRSIQTVGLILDVISISNIILVLSTLAMVVSVFLNAHIWCIKPYPLGLRFEMYLMMTCGFISFWAIAWLSLFYCIKVVNFSSEIFRTLKKNISTVINTAVTLSCLFSFLLFLPAFSLDLPDSADKNISETNITTCPQPTFTLQIDINAYAAAVLLLICPIPLMIMLPTSVRMVVHLCAHTRALQKNQTQVQGSDSYLLVCKLTISLVGVYLSTLFMVALYFIIKVLGAFMTYQALVSAFTFYCGMTSVLLTASNRYLKDKLWSLFCCRKAKEPVSKSQTVVTQDV"
misc_feature 100..879 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="seven-transmembrane G protein-coupled receptor superfamily; Region: 7tm_GPCRs; cl28897" /db_xref="CDD:452889" misc_feature 127..192 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 2 [structural motif]; Region: TM helix 2" /db_xref="CDD:410628" misc_feature 250..318 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:410628" misc_feature 397..447 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:410628" misc_feature 532..615 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:410628" misc_feature 691..747 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:410628" misc_feature 781..867 /gene="tas2r200.1" /gene_synonym="tas2r1a" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:410628" exon 1..963 /gene="tas2r200.1" /gene_synonym="tas2r1a" /inference="alignment:Splign:2.1.0" ORIGIN
atgagcaccgacgttgggaacgttctttttttcgttggagttggggttgtcggtgtttctggaaacatattcaaccttatctttagcttacaacagcaagtaaaaaccagatccattcagactgtgggcttaatcctagatgtcatctccatcagcaacatcatcttggtactttccactctcgccatggtggttagtgtgtttctgaatgcccacatttggtgcatcaagccatatcctctcggtctccgttttgaaatgtatctaatgatgacttgcggcttcatcagcttctgggccattgcttggctgagtcttttctactgcatcaaagttgtgaatttctcctctgagatcttcagaacattgaagaagaacatctcaactgtgatcaacactgcggtgacgttgagctgcttgttctccttcttgctattccttccagcgttcagcctcgatcttccagattcagcggataaaaatatcagcgagacaaatatcacaacctgtccacagccgactttcactctacagatagacataaatgcatacgcagccgctgtcctgctcctcatctgcccgatccctctgatgatcatgttgcccacctctgtcagaatggtggtccacctctgcgcccacacacgggcactccagaagaaccagacgcaggtgcagggatccgactcgtatctcttggtgtgcaaactcaccatctctctggtgggagtttatctgtccactctatttatggtggcattgtatttcattataaaggttttgggggcatttatgacatatcaagccctagtcagtgcctttactttttactgtggaatgacttcagtgctactgacggcatcaaacaggtatctgaaagataaactttggagtctgttctgttgcaggaaagcaaaggagccagttagcaaaagtcagacagttgtgacacaggatgtctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]