GGRNA ver.2 Help | Advanced search | English    旧バージョン

2025-11-16 02:15:00, GGRNA : RefSeq release 232 (Sep, 2025)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)
LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...
XM_024651321.1 - Strongyloides ratti - NCBI
Caenorhabditis elegans PAZ domain-containing protein (wago-10), mRNA. (3217 bp)
misc_feature 1097..1375 /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1178..1180,1223..1225,1256..1258,1268..1270, 1322..1324,1343..1345,1349..1351) /gene="wago-10" /locus_tag="CELE_T22H9.3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /...
NM_070776.5 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)
LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062931429.1 - Colletotrichum destructivum - NCBI
Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)
LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...
XM_062919679.1 - Colletotrichum destructivum - NCBI
Verticillium alfalfae VaMs.102 argonaute partial mRNA. (2883 bp)
misc_feature <400..618 /locus_tag="VDBG_03564" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 649..807 /locus_tag="VDBG_03564" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 913..1248 /locus_tag="VDBG_03564" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_003005565.1 - Verticillium alfalfae VaMs.102 - NCBI
PREDICTED: Zootermopsis nevadensis protein argonaute-1-like (LOC110838885), mRNA. (819 bp)
samples with support for all annotated introns" /db_xref="GeneID:110838885" CDS 82..414 /gene="LOC110838885" /codon_start=1 /product="protein argonaute-1-like" /protein_id="XP_021938223.1" /db_xref="GeneID:110838885" /translation="MEICNLSSEDLHRELSKERKRDFMNYILGLNVDYMLPNVPTSKRTCKVNRVVENAVKQMFELDSGRSISVAEYIAQEKKIRLSYPHLLCLHVGSLNRCSPIYAPAEVSKA" misc_feature <238..402 /gene="LOC110838885" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been...
XM_022082531.1 - Zootermopsis nevadensis - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)
LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...
XM_024650915.1 - Strongyloides ratti - NCBI
Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)
misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...
XM_024651181.1 - Strongyloides ratti - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC component 1 (ago1), transcript variant X5, mRNA. (4807 bp)
misc_feature 256..408 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 409..786 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(580..582,625..627,667..669,679..681,733..735, 754..756,760..762) /gene="ago1" /note="nucleic acid-binding...
XM_028975414.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 3b (ago3b), mRNA. (2831 bp)
misc_feature 290..574 /gene="ago3b" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 602..754 /gene="ago3b" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 755..1117 /gene="ago3b" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788702.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 2 (ago2), transcript variant X2, mRNA. (2890 bp)
misc_feature 426..650 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 678..830 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 831..1193 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788641.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Chanos chanos argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (2592 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_030788751.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Chanos chanos argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (2625 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_030788750.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Stylophora pistillata protein argonaute-2-like (LOC111346866), mRNA. (2488 bp)
misc_feature 239..469 /gene="LOC111346866" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 497..649 /gene="LOC111346866" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature <731..1012 /gene="LOC111346866" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_022954129.1 - Stylophora pistillata - NCBI
PREDICTED: Monopterus albus argonaute RISC component 4 (ago4), mRNA. (3372 bp)
misc_feature 356..745 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 776..928 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 929..1291 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_020597641.1 - Monopterus albus (swamp eel) - NCBI
PREDICTED: Gadus morhua argonaute RISC component 1 (ago1), transcript variant X4, mRNA. (2924 bp)
misc_feature 537..929 /gene="ago1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 957..1109 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1110..1490 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030358231.1 - Gadus morhua (Atlantic cod) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (6349 bp)
misc_feature 265..651 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 682..834 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 835..1197 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735679.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Macaca fascicularis argonaute RISC catalytic component 3 (LOC102144351), transcript variant X9, mRNA. (2565 bp)
misc_feature 142..483 /gene="LOC102144351" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(277..279,322..324,364..366,376..378,430..432, 451..453,457..459) /gene="LOC102144351" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 616..1893 /gene="...
XM_015438461.4 - Macaca fascicularis (crab-eating macaque) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X9, mRNA. (6346 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735682.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X8, mRNA. (6345 bp)
misc_feature 276..662 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 693..845 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 846..1208 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735680.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (6360 bp)
misc_feature 276..662 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 693..845 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 846..1208 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735678.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X5, mRNA. (6364 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735677.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X4, mRNA. (6367 bp)
misc_feature 265..651 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 682..834 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 835..1215 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735676.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Chanos chanos argonaute RISC catalytic component 2 (ago2), transcript variant X1, mRNA. (2938 bp)
misc_feature 474..698 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 726..878 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 879..1241 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_030788640.1 - Chanos chanos (milkfish) - NCBI
PREDICTED: Gadus morhua argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (2643 bp)
misc_feature 85..474 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 505..657 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 658..1020 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_030346975.1 - Gadus morhua (Atlantic cod) - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC component 1 (ago1), transcript variant X4, mRNA. (2836 bp)
misc_feature 452..844 /gene="ago1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 872..1024 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1025..1402 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_028975413.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Salmo trutta argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (6379 bp)
misc_feature 277..663 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 694..846 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 847..1227 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029735675.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Parambassis ranga argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (6533 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_028422514.1 - Parambassis ranga (Indian glassy fish) - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC catalytic component 2 (ago2), mRNA. (3736 bp)
misc_feature 429..653 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 681..833 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 834..1196 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_028963480.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Acanthisitta chloris argonaute RISC catalytic component 4 (AGO4), partial mRNA. (2428 bp)
misc_feature 191..445 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 476..628 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 629..991 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_009082080.1 - Acanthisitta chloris (rifleman) - NCBI
PREDICTED: Enhydra lutris kenyoni protein argonaute-3 (LOC111142870), transcript variant X3, mRNA. (2710 bp)
misc_feature 67..408 /gene="LOC111142870" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(202..204,247..249,289..291,301..303,355..357, 376..378,382..384) /gene="LOC111142870" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 541..1818 /gene="...
XM_022496242.1 - Enhydra lutris kenyoni (northern sea otter) - NCBI
PREDICTED: Parambassis ranga argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (6566 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_028422506.1 - Parambassis ranga (Indian glassy fish) - NCBI
PREDICTED: Echeneis naucrates argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (2592 bp)
misc_feature 82..471 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 502..654 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 655..1017 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc...
XM_029513747.1 - Echeneis naucrates (live sharksucker) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X8, mRNA. (15152 bp)
misc_feature 176..517 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(311..313,356..358,398..400,410..412,464..466, 485..487,491..493) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 650..1927 /gene="AGO3" /note="PIWI...
XM_019938127.3 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (15252 bp)
misc_feature 276..617 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(411..413,456..458,498..500,510..512,564..566, 585..587,591..593) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 750..2027 /gene="AGO3" /note="PIWI...
XM_033838026.2 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Tursiops truncatus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (15334 bp)
misc_feature 358..699 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(493..495,538..540,580..582,592..594,646..648, 667..669,673..675) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 832..2109 /gene="AGO3" /note="PIWI...
XM_033838019.2 - Tursiops truncatus (common bottlenose dolphin) - NCBI
PREDICTED: Echeneis naucrates argonaute RISC component 4 (ago4), transcript variant X8, mRNA. (2742 bp)
misc_feature 262..651 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 682..834 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 835..1197 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029513748.1 - Echeneis naucrates (live sharksucker) - NCBI
PREDICTED: Cottoperca gobio argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (6941 bp)
misc_feature 244..633 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 664..816 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 817..1179 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029442881.1 - Cottoperca gobio - NCBI
PREDICTED: Salmo trutta argonaute RISC catalytic component 2 (ago2), transcript variant X5, mRNA. (6568 bp)
misc_feature 850..1074 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1102..1254 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1255..1617 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_029732585.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Pygoscelis adeliae argonaute RISC catalytic component 1 (AGO1), mRNA. (6664 bp)
misc_feature 236..460 /gene="AGO1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 488..640 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 641..1003 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_009328224.1 - Pygoscelis adeliae (Adelie penguin) - NCBI
PREDICTED: Salmo trutta argonaute RISC catalytic component 2 (ago2), transcript variant X4, mRNA. (6583 bp)
misc_feature 850..1074 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1102..1254 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1255..1617 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_029732584.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Cottoperca gobio argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (6956 bp)
misc_feature 244..633 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 664..816 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 817..1179 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029442880.1 - Cottoperca gobio - NCBI
PREDICTED: Cottoperca gobio argonaute RISC catalytic component 2 (ago2), transcript variant X6, mRNA. (10991 bp)
misc_feature 316..540 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 568..720 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 721..1083 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_029442470.1 - Cottoperca gobio - NCBI
PREDICTED: Salmo trutta argonaute RISC catalytic component 2 (ago2), transcript variant X3, mRNA. (6590 bp)
misc_feature 851..1075 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1103..1255 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1256..1636 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_029732583.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta protein argonaute-3 (LOC115177110), transcript variant X3, mRNA. (3310 bp)
misc_feature 1028..1312 /gene="LOC115177110" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1340..1492 /gene="LOC115177110" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1493..1855 /gene="LOC115177110" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...
XM_029737621.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC catalytic component 2 (ago2), transcript variant X2, mRNA. (6600 bp)
misc_feature 852..1076 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1104..1256 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1257..1637 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_029732582.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Salmo trutta argonaute RISC catalytic component 2 (ago2), transcript variant X1, mRNA. (6603 bp)
misc_feature 852..1076 /gene="ago2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1104..1256 /gene="ago2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1257..1637 /gene="ago2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD...
XM_029732581.1 - Salmo trutta (river trout) - NCBI
PREDICTED: Denticeps clupeoides argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (2769 bp)
misc_feature 241..630 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 661..813 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 814..1176 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_028963589.1 - Denticeps clupeoides (denticle herring) - NCBI
PREDICTED: Monopterus albus argonaute RISC component 1 (ago1), mRNA. (6886 bp)
misc_feature 352..744 /gene="ago1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 772..924 /gene="ago1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 925..1287 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...
XM_020590149.1 - Monopterus albus (swamp eel) - NCBI
PREDICTED: Rhinolophus sinicus argonaute RISC catalytic component 3 (LOC109444829), transcript variant X7, mRNA. (2145 bp)
misc_feature 131..472 /gene="LOC109444829" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(266..268,311..313,353..355,365..367,419..421, 440..442,446..448) /gene="LOC109444829" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 605..1882 /gene="...
XM_019726516.2 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : https://ggrna.dbcls.jp/ja/Argonaute+%22PAZ+domain%22
lang : ja | div : | spe : | query_string : Argonaute "PAZ domain" | format : html | download :

0.000 | 0.000 | search_start;
0.092 | 0.092 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.111 | 0.018 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.281 | 0.170 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.290 | 0.009 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]