GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2021-12-06 05:48:35, GGRNA : RefSeq release 208 (Sep, 2021)



Matches are highlighted with green background. Overlapping matches are dark colored.

PREDICTED: Zonotrichia albicollis uncharacterized LOC113460778 (LOC113460778), ncRNA. (617 bp)
position 191 385
XR_003382616.1 - Zonotrichia albicollis (white-throated sparrow) - NCBI
PREDICTED: Sebastes umbrosus FXYD domain containing ion transport regulator 5 (fxyd5), transcript variant X1, mRNA. (1260 bp)
position 802 1063
XM_037785583.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Sebastes umbrosus solute carrier family 45 member 3 (LOC119475566), mRNA. (4402 bp)
position 2181 2281 2804
XM_037748436.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Epinephelus lanceolatus cysteine-rich and transmembrane domain-containing protein 1-like (LOC117264835), mRNA. (1824 bp)
position 814 1198
XM_033639127.1 - Epinephelus lanceolatus (giant grouper) - NCBI
PREDICTED: Nannospalax galili U6 spliceosomal RNA (LOC115071755), ncRNA. (103 bp)
snRNA" /gene="LOC115071755" /product="U6 spliceosomal RNA" /inference="COORDINATES: nucleotide motif:Rfam:12.0:RF00026" /inference="COORDINATES: profile:INFERNAL:1.1.1" /db_xref="GeneID:115071755" /db_xref="RFAM:RF00026" ORIGIN // gtgcttgcgtcggcatcacttacattaaaattggaatgatacagagattaccatggccctaggtcagaatgacctacaaattggtgaagcgttacattttttt
position 61
XR_003850833.1 - Nannospalax galili (Upper Galilee mountains blind mole rat) - NCBI
Pyricularia pennisetigena uncharacterized protein (PpBr36_01609), partial mRNA. (285 bp)
Sinica, 128 Academia Road, Sec. 2, Nankang, Taipei 11529, Taiwan atgacatcagtggtcccacacaagtgtggcgacaatggagggttccgctgcgccaagcccccccggccttctcccggcagtacagtacaaccaaacggaacgccatgcgaggtgttgcaaaagccgatttcccatcccatcctgcacgaagggtccaactcgcctcatgacgttcccgcctccttcagcggtagcggttggatcgccgagacaaacaaggacgaggtcatcgtgacctgccgcagcttagtacaccaccgcgccaaacctcattcagttcgttga
position 224
XM_029888794.1 - Pyricularia pennisetigena - NCBI
PREDICTED: Corapipo altera uncharacterized LOC113960110 (LOC113960110), ncRNA. (125 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:113960110" ncRNA 1..125 /ncRNA_class="lncRNA" /gene="LOC113960110" /product="uncharacterized LOC113960110" /db_xref="GeneID:113960110" ORIGIN // aggtgtggattgctgagtgataaactgagaaaatgattcgggctaattaagaggaaacagtgtaaggtcaatatgacctggagagagaaaagaaaaacaaatcgtaaaacttaattgggctccta
position 65
XR_003531978.1 - Corapipo altera (White-ruffed manakin) - NCBI
PREDICTED: Sebastes umbrosus zinc-binding protein A33 (si:ch73-54f23.4), mRNA. (2654 bp)
position 1590 1699
XM_037785959.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
PREDICTED: Epinephelus lanceolatus pinopsin-like (LOC117249974), mRNA. (2583 bp)
position 1970 2228
XM_033615908.1 - Epinephelus lanceolatus (giant grouper) - NCBI
PREDICTED: Scophthalmus maximus Fas apoptotic inhibitory molecule 2b (faim2b), transcript variant X2, mRNA. (2555 bp)
position 2101 2231
XM_035630396.1 - Scophthalmus maximus (turbot) - NCBI
PREDICTED: Scophthalmus maximus Fas apoptotic inhibitory molecule 2b (faim2b), transcript variant X1, mRNA. (2556 bp)
position 2103 2233
XM_035630395.1 - Scophthalmus maximus (turbot) - NCBI
PREDICTED: Gigantopelta aegis uncharacterized LOC121371050 (LOC121371050), mRNA. (1963 bp)
position 1741 1887
XM_041496673.1 - Gigantopelta aegis - NCBI
Fusarium subglutinans uncharacterized protein (FSUBG_11968), partial mRNA. (333 bp)
USA atgtttcacctcaacgcttccgccgtgagatccgggatggccatgttcatcttgtcaatggacgggatgttctgggccccgatggtggttctaactcttggaataccctattacgtggcaagcggcggcccaataccaacgccagggaaggaagccaaagtgcctggtgtcgaaggaacctacgccgctatcatcgacaatccggagagccccatggaagtctacaagatgatgccgcgcggtaaacttagtatcatcgttgctgtgcccccgaacgggtcagaggtcagcatgacctctaccgaaatcccatggtctgtcttcaaggcgtaa
position 284
XM_036676707.1 - Fusarium subglutinans - NCBI
PREDICTED: Tachyglossus aculeatus U6atac minor spliceosomal RNA (LOC119943154), ncRNA. (124 bp)
snRNA" /gene="LOC119943154" /product="U6atac minor spliceosomal RNA" /inference="COORDINATES: nucleotide motif:Rfam:12.0:RF00619" /inference="COORDINATES: profile:INFERNAL:1.1.1" /db_xref="GeneID:119943154" /db_xref="RFAM:RF00619" ORIGIN // gtgctgtaggaaaggagaaaggttagcactcccctggaggatggaagaggtcatagtgacctttacaacacatgtaaggttaagatattgccaccgacttcatagcatctaaccatgttttaga
position 48
XR_005455629.1 - Tachyglossus aculeatus (Australian echidna) - NCBI
PREDICTED: Dermacentor silvarum uncharacterized LOC119445864 (LOC119445864), mRNA. (477 bp)
ORIGIN // atgaggctgcaccaaggaggcatcacgcactactttgatgtgtggcatgtggcaaaaggtatccgcaaaaagattactgcgacatccaggaaaggtggttgcagttccctcaaagaatggatccaggcaattgtcaaccacctctactggtgtgcccgtgcatgtggtggcaatgcagacctggtggtggctgcatggggtagtattttcaaccacacagtcaacatccacgaaggtcacaatgaccttttccccaggtgccttcacggacctcctcgccgtatctcatggctcagtgcaggttctccagcatacaaggcactcaaggaaatcgtgacagcacctctactgctcagagacatacgtcagctgtcaccatcggcacagacgtacagccttgaatcatttcatagtgtgctcaacggctttgcacccaaattgactgcattcacatacgaaggcatgaaagctcggtag
position 234
XM_037710172.1 - Dermacentor silvarum - NCBI
PREDICTED: Crassostrea virginica uncharacterized LOC111113719 (LOC111113719), mRNA. (406 bp)
uncharacterized protein LOC3719" /protein_id="XP_022307717.1" /db_xref="GeneID:3719" /translation="MTSIVEDINDRHMKPWAEACQRDGIDNTPLNPFIDQELLYNKNLSLDSAKLKGTGFTYSIPELKIDSLREILDDYIKCGLFPRSLLSAEMLWNCEAEHEETEEILANQNGS" ORIGIN // ctgccatctgcatgattgaggacgagtttgtgagattgaacttgtgttgtttaaaggaaaacaggtcaacatgacctccattgtagaagacatcaatgatcgtcacatgaagccctgggctgaagcttgtcagagggacggcatagacaacacgccgctcaaccccttcatagaccaggaactgttatacaataagaatctatctttagacagtgccaaactcaaggggactggatttacttatagtataccagagctaaaaatagattcactcagagagattttagatgattatatcaaatgtggactttttcctcgatcgctcttatcagcggaaatgttgtggaactgcgaggctgaacatgaagagacagagga...
position 63
XM_022452009.1 - Crassostrea virginica (eastern oyster) - NCBI
PREDICTED: Fundulus heteroclitus uncharacterized LOC118557761 (LOC118557761), ncRNA. (574 bp)
uncharacterized LOC118557761" /db_xref="GeneID:118557761" ORIGIN // aggacaggagtgtttgacccttggtcgcaacgagttgggctgaattgttttcactttaattgccttctaaaatagaaggcaattaatttttttcttcacttcatcgcttgtgtgcctacaaggatatttttgccacggagacctttttactgaaaggttcgaagattttattacagttgacttctgctttgaccgtgacctctttagtattagatttcaggtcataatgacctggatttacactaaaagataccatgagattattctactgcaggcaacctgtccaaggtgtcccccaccactcaaccaatgaccgctggagatggacaccaggcactcccccaaccctacaacgataagcagatgattttacaccattacggtctgccagtgggagggtttccgtggaacaattcttctgaaaggaatccccggggacgcactcattcatatgatgtgtttcaacatagtgtttgagctgggaattgtcctgcgacgtgatgtactgcagtcataagagcagctgttgaga...
position 219
XR_004927981.1 - Fundulus heteroclitus (mummichog) - NCBI
PREDICTED: Heterocephalus glaber uncharacterized LOC110350447 (LOC110350447), ncRNA. (526 bp)
genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:110350447" ncRNA 1..526 /ncRNA_class="lncRNA" /gene="LOC110350447" /product="uncharacterized LOC110350447" /db_xref="GeneID:110350447" ORIGIN // gtatgtcaccatatagggaaatccccattgaggtcactatgacctggggacttggggccatcaccttggtcactttctaatacctgccacaggcctaaacactcacccttgccatgtgatgtttcgatgatccagtctacaaataattgaagagacattgatcccttaaattgaggggatgaatgcagaagatgatgacagagtgagtgtgagcatgagatgttattttacttcaagttcatggtcaaatactgtccccagagtacccctcatggggccactcagctacacacagagaaagctgtgagagttgtcaggcctgagccagaggcatcagccca...
position 31
XR_002397038.1 - Heterocephalus glaber (naked mole-rat) - NCBI
Helobdella robusta hypothetical protein partial mRNA. (168 bp)
A., Putnam,N.H., Grigoriev,I.V. and Rokhsar,D.S. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (18-DEC-2012) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA aatggcgactacgttgaaattcaaacctctttcgggctgaccgtgtcatacaaccccctgtggaggttaaaggtcacagtgacctccgccttcagtaatcaagtgaccggaagttgcggaaattttgacggaaatccaagtaatgatgtcaaaatggtgaacggcgct
position 71
XM_009030703.1 - Helobdella robusta - NCBI
PREDICTED: Ipomoea nil heavy metal-associated isoprenylated plant protein 32-like (LOC109153142), mRNA. (424 bp)
position 289
XM_019300941.1 - Ipomoea nil (Japanese morning glory) - NCBI
PREDICTED: Nothobranchius furzeri mitochondrial ribosomal protein L49 (mrpl49), mRNA. (660 bp)
position 517
XM_015968871.1 - Nothobranchius furzeri (turquoise killifish) - NCBI
PREDICTED: Paralichthys olivaceus mitofusin-1-like (LOC109623919), partial mRNA. (630 bp)
gene="LOC109623919" /note="G1 box; other site" /db_xref="CDD:206648" misc_feature 419..421 /gene="LOC109623919" /note="G2 box; other site" /db_xref="CDD:206648" misc_feature 425..433 /gene="LOC109623919" /note="Switch I region; other site" /db_xref="CDD:206648" ORIGIN // acatgttacgttcacgatgaggtcactatgacctttgacctctgaaatctaatcaattcatctttcaaccagttttgaggaaattccttcgaggtgttgttgagatatcgtgttgacaagaaagaaacagcctctgaccactgggggtcgctggtgtaaacaatacaaacgtgacaatgtgacctgtgtttgttgcgtgatgtcagaggcatggcggagcgacgacctgggccaggtggcggtggaggagcagagcgtggacatgcagagctgtgccaccaaactgtcgaccatcagggacgttttgctgcggaggcacatgaaggtg...
position 20
XM_020078377.1 - Paralichthys olivaceus (Japanese flounder) - NCBI
PREDICTED: Dasypus novemcinctus galectin-2-like (LOC111762579), mRNA. (570 bp)
position 428
XM_023586884.1 - Dasypus novemcinctus (nine-banded armadillo) - NCBI
PREDICTED: Diaphorina citri multiple inositol polyphosphate phosphatase 1-like (LOC103517490), mRNA. (1022 bp)
position 593
XM_008482525.3 - Diaphorina citri (Asian citrus psyllid) - NCBI
Grosmannia clavigera kw1407 hypothetical protein partial mRNA. (294 bp)
Columbia, Faculty of Forestry The University of British Columbia 4th floor, Vancouver, British Columbia V6T 1Z4, Canada atgcctatcagactggccaggatttacttcaggcggctgaccatctggagcagtcttttgttgttgaccacgggctacttcctattctcagacgtgttgcccgacgtggccaatcatgccctacgcaagccccttcgctcgcagtggcatcctatcgaccgcttaatcgatgaggtcaacatgacctttcaccgcctcctgcagtcacgctcaacaaacttgagcgatgcagcagcgcgctaccgcgagcggcggggccgtcacccgccgcctggtttcggcgcgtggtggtag
position 173
XM_014312835.1 - Grosmannia clavigera kw1407 - NCBI
PREDICTED: Hippoglossus hippoglossus uncharacterized LOC117757739 (LOC117757739), ncRNA. (244 bp)
of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:117757739" ncRNA 1..244 /ncRNA_class="lncRNA" /gene="LOC117757739" /product="uncharacterized LOC117757739" /db_xref="GeneID:117757739" ORIGIN // gccaaaggtcaaaggtcacggtgacctcacagaacaaaaaatgagaaactgtcacagggaccccatataaatctggaaaaaaatacgcacacagtgcagtgtttctagttattgttattgtctgatccttttatataagaatggtaaagtctactgtcataatgtggtgttggttttaattcaagtattttatcaagtgtttcaatcattgaaatattgacataataaactgcatatatacaga
position 13
XR_004613194.1 - Hippoglossus hippoglossus (Atlantic halibut) - NCBI
PREDICTED: Benincasa hispida signal peptidase complex subunit 3B-like (LOC120070765), mRNA. (686 bp)
gene="LOC120070765" /note="Signal peptidase subunit; Region: SPC22; pfam04573" /db_xref="CDD:398327" ORIGIN // atgcattcttttggttatcgagccaatgctttggtcactttcgccgtcaccattctcgtaattatgtgcgccatggcctctttctccgataacttcaactctccctctcccaccgccagtgttcaggtgttgaacatcaactggtttcagaagcagcttcatggaaatgacgaggtcagcatgaccttaaatatctcggtggacttgcagtcactatttacatggaacacaaagcaggtttttgtttttgtagctgctgagtatgaaactcctaagaattccttgaaccagatctcgctttgggatggtataataccttccaaagataatgccaaatttacgattcacacttcaaacaagtaccgtttcatcgatcagggaagcaatctcagaggtaaagaattcaacttgacgctgcattggcatgtaatgccaaaaaccggtaaaatgttcgctgataagatagtgatgtctgggtatcgcttaccg...
position 173
XM_039022647.1 - Benincasa hispida (wax gourd) - NCBI
Aspergillus heteromorphus CBS 117.55 uncharacterized protein (BO70DRAFT_360327), mRNA. (434 bp)
R.P., Mortensen,U.H., Andersen,M.R., Baker,S.E., Grigoriev,I.V., Nordberg,H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (16-DEC-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA gatgacttgccaggtcaacatgacctcgagtcgacatgcaataaacccgggaccgaccaattggtcgctacaacataatctcctgcagcccagcgcggacgcggccgttggaccccatcggcatccacaggtcacaacccgcggacaagggtcaccagctgtcgccacaccaacgcacgagacaaacgggcatgtagcggtgtagccgatggcaccagccaccacgggaagcgtgagttggctcgcatgaaggattgggctccggagcacaaccgcgggtgtacgtagaccagacaagacaatcatattaatggctcagcag...
position 12
XM_025542753.1 - Aspergillus heteromorphus CBS 117.55 - NCBI
PREDICTED: Acropora digitifera C-type lectin domain family 17, member A-like (LOC107330065), mRNA. (585 bp)
position 468
XM_015894708.1 - Acropora digitifera - NCBI
Opisthorchis viverrini hypothetical protein partial mRNA. (474 bp)
Melbourne, Cnr Park Drive and Flemington Road, Parkville 3010, Australia atgggggcagttgctgggttgaatgcaaagcgcttctctagccacggtgacgggaaggatgatggggaatctgggcacagcaatcgcttagaagaaaatgtgtgcggccgcattatcggcatcggaaaagaggaaaaagccgaagcacatgatgtgttaattagtacgttagacgtgtcgttctgcgcgatggaatgtctcccagttggaatatttcaaggtcattatgacctactggtgctccgcaacgatggggctatagagtatgtgttcagcgcacttttcggtattttgaattatccattggaacaggtcggcttcggcagcgggtctattcggccgcttttcaggtgtatcttgccacttgcaaagctgcgtcccattcactactttcgacctccgaccatcttgaatggtatagacgttcccccagcgatcggtgactacgaacgtcccttgccatcgactgcctag
position 219
XM_009177955.1 - Opisthorchis viverrini - NCBI
Ustilago maydis 521 hypothetical protein (UMAG_02463), partial mRNA. (1041 bp)
position 963
XM_011390444.1 - Ustilago maydis 521 - NCBI
Malassezia globosa CBS 7966 hypothetical protein MGL_3153 partial mRNA. (414 bp)
Miami Valley Innovation Center, The Procter & Gamble Company, 11810 East Miami River Road, Cincinnati, OH 45252, USA atggttcgcttcgcatcgctggctgtttcgcttgtcactcttatcgctgctgctatgccaagcacggcatttgatgctcgcagcgacctcaacgcgcgaatggtttatgacccgaagattctctacccgacgcacgatactgtgtggaaggtgggcgacaaggtcaacgtgacctggcgtgctgctgacatgcctcgcgaatttagggaatacacgggtaaggttattcttggacacattgagcctggctcaatgaatgaacatctggcgaacacgctcgccgaagacttcaaaatggccgatggtaacgtgacctttacagtgccgcacgtaaaggaacgcgatgactacgtggtggtgctgatgggagactctggcaaccactcacctaagtttaccatccgctccgcttaa
position 161
XM_001729557.1 - Malassezia globosa CBS 7966 - NCBI
PREDICTED: Marmota flaviventris uncharacterized LOC114092506 (LOC114092506), ncRNA. (399 bp)
position 352
XR_003582754.1 - Marmota flaviventris (yellow-bellied marmot) - NCBI
PREDICTED: Scleropages formosus C-C motif chemokine ligand 28 (ccl28), mRNA. (487 bp)
position 313
XM_018759114.1 - Scleropages formosus (Asian bonytongue) - NCBI
PREDICTED: Pteropus giganteus ubiquinol-cytochrome-c reductase complex assembly factor 3 (LOC120600850), mRNA. (750 bp)
position 521
XM_039860438.1 - Pteropus giganteus (Indian flying fox) - NCBI
PREDICTED: Glycine soja uncharacterized LOC114391506 (LOC114391506), mRNA. (573 bp)
IV of spliceosomal protein Prp8; Region: RNase_H_like; cl14782" /db_xref="CDD:353835" ORIGIN // atggacccaatcaagtacatcttagaaaaacttgctctcattggatggatcgcttggtggcaggttctaccatcggaatttgacattgtttatgtcactcaaaaggcgataaaggggagtgccttggcagattacctggctcaacagcccatcaatgactaccagcctatgcatccagaattccttgatgaggtcatcatgaccttctttaagggggaagtagaggataaagatagggacaaatggattatgttgggttttgaatgcacaaacaacatagccgagtataaggcgtgcgcccttgggatccaagcaacaattcacttcaaggtcaagttgctcaaggtctacatcaggaagttgataggattctttgatgacatatcctttcatcacattcctagagaggagaatcagatggccaatgcccttgccactctagcatccatgttccaactaacctcgcatagggatttgccgtacatcaaattcagatgttgtggc...
position 191
XM_028352510.1 - Glycine soja - NCBI
PREDICTED: Glycine max uncharacterized LOC102661198 (LOC102661198), mRNA. (513 bp)
order(259..261,445..447) /gene="LOC102661198" /note="active site" /db_xref="CDD:259998" ORIGIN // atggacccagtcaagtacatatttgaaaagcccaccctcaccgaacagatcgctcggtggcaggttctattgtcagaattcaacattgtttatgtcacacaaaaggcaataaagggaagtgccttggaagactacttggctcagcagcccatcaatgactatcaaccaatgcaccccgagttccctgacgaggtcatcatgaccttgttcgaggaggagatgggggatgaagatagggagaaatggattgtgtggtttgacggcaagtccaacgcactaggccatagagtaggggcagttttggttacccccgatgatcaatgtatacccttcacagctaggttgggcttagactgcatgaataacatgtctgagtacgaggcatgcgcccttgggatccaagcagcaattgacttcaaggtcaagttgctcaaagtatatggggacttagcctttgtgatccaccaattgaaaggagaatgggagaccagggatcacaagt...
position 191
XM_006603341.1 - Glycine max (soybean) - NCBI
PREDICTED: Picoides pubescens aquaporin 8 (AQP8), mRNA. (774 bp)
position 476
XM_009900537.1 - Dryobates pubescens (Downy woodpecker) - NCBI
Plasmopara halstedii polyprotein (PHALS_11464), partial mRNA. (603 bp)
Georg-Voigt-Stra.e 14-16, D-60325 Frankfurt am Main, Germany atgaattgctccccaaatacagctcatcctgttttcacgctgtacgagttggctttcaaggaaaagccccaaatggatcactttcgcgtgtttggatcgcaaagttacgctcatgccgacgctgtcaaaaggattaagctggaacccaagagcttcaagtgtatgttactcggctacgcggaaaatgtaaagggctatcgcgtgtttgacttgaaaaatgccaaggtcaaagtgacctgttatgtgaagttggatgagcgtgaagtcaatggaatcgacgacactcatgcgctaaagccagccacaattgttcaagtaatcgaggacaatgatgaagtcaagattcagcatcaagtggatatacagcctatgatagacaatcccgtggaaactgtgaaagagccagttatagatgtcaaaatgggagatatcgagcgaacgccaagcgttgatgtaaatcatctaatggcttctgagcgctccatcgtaaactctttgggttttaccttctattcaacacagatcttgccgataaaaat...
position 224
XM_024725903.1 - Plasmopara halstedii - NCBI
Metarhizium brunneum ARSEF 3297 hypothetical protein partial mRNA. (465 bp)
Road, Shanghai, Shanghai 200032, China atggcaaactctgcgaagcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcttgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgttaaggagagatggaatgtgcgaacatttatcgtcttcgacatcttccacgacacctacgatcccgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagataatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtgcaagaaatccacgatgcgactggaatcggaagtcggcctcctttcagcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactataatatctcctccttga
position 252
XM_014684551.1 - Metarhizium brunneum ARSEF 3297 - NCBI
Metarhizium robertsii ARSEF 23 hypothetical protein mRNA. (465 bp)
Road, Shanghai, Shanghai 200032, China atggcaaactctgcgaggcgaattctggtgagcgtctcgagtaagagcccctactggtccgaggcatgggaatccagcatgcaggtgatcgaaacggcacttggactcctcaaagagagcaagctggtttgttccgatggcaaccaagacgcgaaaccgaaatttatcgtaaaggagagatggaatgtgcgaacatttatcgtcttcgacatctttcacgacacctacgatcctgatactgcgcatctttcaggtcagaatgacctgccagtcatttcagtcttcttgggcgagaaaatcagcatgaatgtggcaagcaactttgtggagaatgaagtcaacagaaaagtccaagaaatccacgatgcgactggaatcggaagtcggcctcctttcatcgtcgatcacatgtatggaaacgtgcctagttatcccaacccgcggactgtaatatctcgtccttga
position 252
XM_007819355.1 - Metarhizium robertsii ARSEF 23 - NCBI
PREDICTED: Puma yagouaroundi uncharacterized LOC121011838 (LOC121011838), ncRNA. (818 bp)
position 762
XR_005781792.1 - Puma yagouaroundi (jaguarundi) - NCBI
PREDICTED: Setaria italica uncharacterized LOC111256352 (LOC111256352), mRNA. (576 bp)
db_xref="GeneID:111256352" /translation="MDCPNTNPKRSEVTVTCPSDDAIVEILSRLPAKLRFRFKKFPQTLEGFFFGGSPYENYGHFVDLFGRPSPLVDASFSFLTGLPEIEKINLLGSCNGLLLFGHRRVSDMNDSLGYIVCNPATEQWVAVPSSGWTPSPLDDSACTYLIFDPAVSSHFQLVQFTQDDEGAILQFRRNADDNEVEGVAEVRTLLI" ORIGIN // atggattgccccaacaccaaccccaagaggagcgaggtcacggtgacctgcccctccgacgacgcaatcgtggagatcctctcgcgcctccccgccaagcttcgcttccggttcaagaaattcccccagactctagaagggttcttcttcggtggtagcccttatgagaactatgggcatttcgtcgatctgttcgggagaccctcgcccctcgtcgatgcttcgttctcgttcctcactggactgcctgagattgagaagatcaaccttttgggttcctgcaatgggctcctgctcttcgggcacagacgggtttcagacatgaatgactcactgggctatattgtgtgcaaccc...
position 35
XM_022824234.1 - Setaria italica (foxtail millet) - NCBI
PREDICTED: Paralichthys olivaceus uncharacterized LOC109628451 (LOC109628451), ncRNA. (846 bp)
position 704
XR_002202652.1 - Paralichthys olivaceus (Japanese flounder) - NCBI
Isaria fumosorosea ARSEF 2679 hypothetical protein (ISF_06734), partial mRNA. (306 bp)
Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and Wang,C. TITLE Direct Submission JOURNAL Submitted (03-DEC-2013) Institute of Plant Phyiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fengling Road, Shanghai, Shanghai 200032, China atggctgctcttgctcttctgcatttcccgcctcggaacatcggtgaggtcaaggtgacctgggccacaccgctgtggggtggcaaggacaactgccacaattaccagtacggcaacgccatcaagatggccaactgctaccaggggagcttccagtgcaacttcttctacaacaaggactacacgggcgcgtcgacgaagctcttctacaacgggcagtgcgtcggcggcgcgcagcagctcaagtcgtttgcgtgctactactatgtacaagtagttttgggtggtggtctggaaaatgtatag
position 47
XM_018850338.1 - Cordyceps fumosorosea ARSEF 2679 - NCBI
PREDICTED: Glycine max uncharacterized LOC112999920 (LOC112999920), mRNA. (573 bp)
IV of spliceosomal protein Prp8; Region: RNase_H_like; cl14782" /db_xref="CDD:353835" ORIGIN // atggacccaatcaagtacatcttagaaaaacttgctctcattggatggatcgcttggtggcaggttctaccatcggaatttgacattgtttatgtcactcaaaaggcgataaaggggagtgccttggcagattacctggctcaacagcccatcaatgactaccagcctatgcatccagaattccttgatgaggtcatcatgaccttctttaagggggaagtagaggataaagatagggacaaatggattatgttgggttttgaatgcacaaacaacatagccgagtataaggcgtgcgcccttgggatccaagcaacaattcacttcaaggtcaagttgctcaaggtctacatcaggaagttgataggattctttgatgacatatcctttcatcacattcctagagaggagaatcagatggccaatgcccttgccactctagcatccatgttccaactaacctcgcatagggatttgccgtacatcaaattcagatgttgtggc...
position 191
XM_026126340.1 - Glycine max (soybean) - NCBI
PREDICTED: Gigantopelta aegis F-box only protein 16-like (LOC121377468), mRNA. (4741 bp)
position 4262 4408
XM_041505470.1 - Gigantopelta aegis - NCBI
PREDICTED: Sebastes umbrosus uncharacterized LOC119485163 (LOC119485163), ncRNA. (328 bp)
position 296
XR_005206202.1 - Sebastes umbrosus (honeycomb rockfish) - NCBI
Batrachochytrium dendrobatidis JAM81 uncharacterized protein (BATDEDRAFT_36418), mRNA. (841 bp)
position 432
XM_006675794.1 - Batrachochytrium dendrobatidis JAM81 - NCBI
Aspergillus versicolor CBS 583.65 uncharacterized protein (ASPVEDRAFT_24252), partial mRNA. (846 bp)
position 627
XM_040809645.1 - Aspergillus versicolor CBS 583.65 - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI :
lang : en | div : | spe : | query_string : iub:aggtcannrtgacct | format : html | download :

0.000 | 0.000 | search_start;
0.095 | 0.095 | count_done;
0.265 | 0.170 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.305 | 0.040 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]