2025-03-13 12:58:04, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS XM_054361246 1773 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens ring finger protein 122 (RNF122), transcript variant X1, mRNA. ACCESSION XM_054361246 VERSION XM_054361246.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060932) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1773 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="8" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1773 /gene="RNF122" /note="ring finger protein 122; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, 21 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:79845" /db_xref="HGNC:HGNC:21147" /db_xref="MIM:620523" CDS 378..773 /gene="RNF122" /codon_start=1 /product="RING finger protein 122 isoform X1" /protein_id="XP_054217221.1" /db_xref="GeneID:79845" /db_xref="HGNC:HGNC:21147" /db_xref="MIM:620523" /translation="
MPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV"
misc_feature 576..716 /gene="RNF122" /note="RING finger, H2 subclass, found in RING finger protein 122 (RNF122) and similar proteins; Region: RING-H2_RNF122; cd16676" /db_xref="CDD:438338" misc_feature order(582..584,591..593,636..638,642..644,651..653, 660..662,693..695,702..704) /gene="RNF122" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:438338" ORIGIN
ctccagcctgggcaacaagagcgaaactccatctaaaaaaaagccgttttcctgagttgataaaccctcgcagagagctccgcgcccggctgtccctggggtgcgaggctggcctggcgggagccgtgtttctggccacaaggccagattagggtgtctgctcctgagcccaagtgaaggccacacctccagacgcgacaacccctcgccccatttctccccaggcctgggtgatgcttctaagttagttcatttcacctgaggctttttggaggttcaggtgatactgggttaggctggagtctgattcctcagcgagctacctgaaagggtgtttctgtggcctgggactggttagcaccaacaagtcctgctcgatgccacccatcagtttccaagaccttccgctcaacatctatatggtcatctttggcacaggcatctttgtcttcatgctcagccttatcttctgctgctattttatcagcaaactgcggaaccaggcacagagtgagcgatacggatataaggaggtggtgcttaaaggtgatgccaagaagttacaattatatgggcagacctgcgcagtctgtctggaagacttcaaggggaaggatgagttaggcgtgctcccgtgccaacacgcctttcaccgcaagtgtctggtgaaatggctggaagttcgctgtgtctgccccatgtgtaacaagcccattgctagtccctcagaggccacgcagaacattgggattctattggatgagctggtgtgagtgctgccgctacaccgagacctggagaagacctcttgcctcatggatgtctggtccctctgcacagctccaaccaacaggactgtagggtgatgacgatcactttcccagtgatgagaagggtggtctaggactgggcttctaccctcagtgcaagaccagtgccagatgtgcccccacttcctgcctcctgaagccttcttccctgctactccatgctggtggcctcacccatcaagaccactgtctcctggtactggactatctacctgccttgtccctgttctgggggaaggtgtccaccccgatcaagaacatggagaaagtcctctttcaaggctcccattaggaggatgagctgccttgacccagaagggatgagacgggctcttacctctctacaaccttccctccccttcccactccttccggagtaaggttagaagggaaggaaggaaagatcaaggaaccaagcgcctccacgggaggcgagggaggctctgtatgaaacagaagagcagggacataaaggaaaatgtcagtgtttacatgggacctatggaaacaaaggctggcgggcgccagctgactccagagtaagagagggcccttcccctgccaggacccacggtgctatccattcagtctcttcctcagttaatctcggagcttcctattccatgttgaggtttgtgggcccctctagaggagggctagttctatacttaaattgattcccaggggcctttttttttttttttttttttttttttgatcaaaaggggtgtggggatgggggtgtctacggttaagcaacagatacctccttccctttgtaaatagtatttttatacttcatcctcgcctctcaggctttagatacgaaatctccagaatggaagggggtggggattttctgttcctccctggagtgggtgagggtgggagaaagttacatatttaaagaaaaataaatttaataacaagtttctctaaccta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]