ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-02-07 09:16:29, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_054358072 663 bp mRNA linear PRI 05-AUG-2025 DEFINITION PREDICTED: Homo sapiens homeobox A7 (HOXA7), transcript variant X1, mRNA. ACCESSION XM_054358072 VERSION XM_054358072.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060931) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2025_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.4 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/01/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..663 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="7" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..663 /gene="HOXA7" /gene_synonym="ANTP; HOX1; HOX1.1; HOX1A" /note="homeobox A7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:3204" /db_xref="HGNC:HGNC:5108" /db_xref="MIM:142950" CDS 258..605 /gene="HOXA7" /gene_synonym="ANTP; HOX1; HOX1.1; HOX1A" /codon_start=1 /product="homeobox protein Hox-A7 isoform X1" /protein_id="XP_054214047.1" /db_xref="GeneID:3204" /db_xref="HGNC:HGNC:5108" /db_xref="MIM:142950" /translation="
MKSQIGGDCVSPLITEASGRINSVPPIKERKLGDVDFIRTTWLQFAVAISLQLQEMLRLPRLDPSLSPACRPLDLGGCGPCGARPPVRTAEIGGGGHVGGHVLRRAPSKRKWGLV"
ORIGIN
tatatacatatacatatatatatggatagatagatagatagatacagatattacagacacacaccttcattacatttccgtatataatttcacaacgtctgattgtaagaagggttttatagcttccctgggagtcaaccgtggctttgtattcaagccgcagatagagagctcaatttatgttaactgcaaataaatagtgaagtcgcagatccgtggatgcagagagaaagctcgatttgtgtaactacaaataaatgaagtcacagatcggtggcgactgcgtctctccactgatcacggaggcctcagggcggataaacagtgtgcctccgattaaggaaaggaagctgggagacgttgactttattcgaaccacatggctccagtttgcggtggcaatctctctgcagctgcaagagatgctgcgccttccccgtctggatccgagtctaagtccggcctgtcgcccactggacctgggcggctgcgggccctgcggagcgagaccacctgtgaggactgctgagattggcggaggcggtcatgtgggcggtcacgtgctgcggcgagctccgtccaaaagaaaatggggtttggtgtaaatctgggggtgtaatgttatcatatatcactctacctcgtaaaaccgacactgaaagc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]