GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-15 07:03:29, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_054358072             663 bp    mRNA    linear   PRI 05-AUG-2025
DEFINITION  PREDICTED: Homo sapiens homeobox A7 (HOXA7), transcript variant X1,
            mRNA.
ACCESSION   XM_054358072
VERSION     XM_054358072.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060931) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2025_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/01/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="7"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..663
                     /gene="HOXA7"
                     /gene_synonym="ANTP; HOX1; HOX1.1; HOX1A"
                     /note="homeobox A7; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     6 samples with support for all annotated introns"
                     /db_xref="GeneID:3204"
                     /db_xref="HGNC:HGNC:5108"
                     /db_xref="MIM:142950"
     CDS             258..605
                     /gene="HOXA7"
                     /gene_synonym="ANTP; HOX1; HOX1.1; HOX1A"
                     /codon_start=1
                     /product="homeobox protein Hox-A7 isoform X1"
                     /protein_id="XP_054214047.1"
                     /db_xref="GeneID:3204"
                     /db_xref="HGNC:HGNC:5108"
                     /db_xref="MIM:142950"
                     /translation="
MKSQIGGDCVSPLITEASGRINSVPPIKERKLGDVDFIRTTWLQFAVAISLQLQEMLRLPRLDPSLSPACRPLDLGGCGPCGARPPVRTAEIGGGGHVGGHVLRRAPSKRKWGLV"
ORIGIN      
tatatacatatacatatatatatggatagatagatagatagatacagatattacagacacacaccttcattacatttccgtatataatttcacaacgtctgattgtaagaagggttttatagcttccctgggagtcaaccgtggctttgtattcaagccgcagatagagagctcaatttatgttaactgcaaataaatagtgaagtcgcagatccgtggatgcagagagaaagctcgatttgtgtaactacaaataaatgaagtcacagatcggtggcgactgcgtctctccactgatcacggaggcctcagggcggataaacagtgtgcctccgattaaggaaaggaagctgggagacgttgactttattcgaaccacatggctccagtttgcggtggcaatctctctgcagctgcaagagatgctgcgccttccccgtctggatccgagtctaagtccggcctgtcgcccactggacctgggcggctgcgggccctgcggagcgagaccacctgtgaggactgctgagattggcggaggcggtcatgtgggcggtcacgtgctgcggcgagctccgtccaaaagaaaatggggtttggtgtaaatctgggggtgtaatgttatcatatatcactctacctcgtaaaaccgacactgaaagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]