2024-04-25 10:07:25, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_203289 2065 bp mRNA linear PRI 25-DEC-2023 DEFINITION Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 2, mRNA. ACCESSION NM_203289 VERSION NM_203289.6 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2065) AUTHORS Hong L, Hong S and Zhang X. TITLE Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer JOURNAL Medicine (Baltimore) 102 (48), e36433 (2023) PUBMED 38050242 REMARK GeneRIF: Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer. REFERENCE 2 (bases 1 to 2065) AUTHORS Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K. TITLE A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer JOURNAL J Med Virol 95 (12), e29264 (2023) PUBMED 38054553 REMARK GeneRIF: A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer. REFERENCE 3 (bases 1 to 2065) AUTHORS Wang X and Dai J. TITLE Concise review: isoforms of OCT4 contribute to the confusing diversity in stem cell biology JOURNAL Stem Cells 28 (5), 885-893 (2010) PUBMED 20333750 REMARK GeneRIF: This review article underscores the importance of identifying and discriminating the expression and functions of OCT4 isoforms in stem cell research. Review article REFERENCE 4 (bases 1 to 2065) AUTHORS Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J. TITLE Mapping of the minimal internal ribosome entry site element in the human embryonic stem cell gene OCT4B mRNA JOURNAL Biochem Biophys Res Commun 394 (3), 750-754 (2010) PUBMED 20230781 REMARK GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to promote internal initiation of translation of OCT4B mRNA in embryonic stem cells was mapped. REFERENCE 5 (bases 1 to 2065) AUTHORS Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao Y, Li L, Zhao H, Zhao W, Lin H and Dai J. TITLE Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response JOURNAL Stem Cells 27 (6), 1265-1275 (2009) PUBMED 19489092 REMARK GeneRIF: OCT4 gene, by the regulation of alternative splicing and alternative translation initiation, may carry out more crucial roles in many biological events. GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG) translation initiation codon. REFERENCE 6 (bases 1 to 2065) AUTHORS Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW. TITLE OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells JOURNAL Stem Cells 26 (12), 3068-3074 (2008) PUBMED 18787205 REMARK GeneRIF: OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells REFERENCE 7 (bases 1 to 2065) AUTHORS Lee J, Kim HK, Rho JY, Han YM and Kim J. TITLE The human OCT-4 isoforms differ in their ability to confer self-renewal JOURNAL J Biol Chem 281 (44), 33554-33565 (2006) PUBMED 16951404 REMARK GeneRIF: DNA binding, transactivation, and abilities to confer self-renewal of the human OCT-4 isoforms differ REFERENCE 8 (bases 1 to 2065) AUTHORS Wey E, Lyons GE and Schafer BW. TITLE A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues JOURNAL Eur J Biochem 220 (3), 753-762 (1994) PUBMED 7908264 REFERENCE 9 (bases 1 to 2065) AUTHORS Takeda J, Seino S and Bell GI. TITLE Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues JOURNAL Nucleic Acids Res 20 (17), 4613-4620 (1992) PUBMED 1408763 REFERENCE 10 (bases 1 to 2065) AUTHORS Schoorlemmer J and Kruijer W. TITLE Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells JOURNAL Mech Dev 36 (1-2), 75-86 (1991) PUBMED 1723621 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DQ486514.1, DQ486515.1 and AI811039.1. On Aug 13, 2020 this sequence version replaced NM_203289.5. Summary: This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]. Transcript Variant: This variant (2, also known as OCT4B) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream in-frame non-AUG (CUG) start codon, compared to variant 1. The resulting isoform (2, also known as OCT4B-190) is shorter at the N-terminus, compared to isoform 1. Variants 2 and 3 encode the same isoform (2). This variant may encode additional isoforms through the use of an alternative downstream AUG start codon, as well as an alternative upstream AUG start codon, which is polymorphic in human populations (AGG allele represented in this RefSeq; see rs3130932). Use of alternate start codons and the non-AUG start codon is described in PMID:19489092. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: KY781166.1, KX151172.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968189, SAMEA1968540 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## non-AUG initiation codon :: PMID: 19489092 ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-332 DQ486514.1 1-332 333-2051 DQ486515.1 1-1719 2052-2065 AI811039.1 11-24 c FEATURES Location/Qualifiers source 1..2065 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6p21.33" gene 1..2065 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="POU class 5 homeobox 1" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" exon 1..1244 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756575303" variation 3..8 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aaaaa" /replace="aaaaaa" /db_xref="dbSNP:1777333579" variation 3 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777333859" variation 5 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151108087" variation 15 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:556183524" variation 19 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777333028" variation 20..21 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777332518" variation 20 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230878174" variation 22 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1343020362" variation 25 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:945378480" variation 33 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:915242328" variation 35 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1473749165" variation 38 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767061672" variation 39 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244144141" variation 41 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777330580" variation 42 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:932840583" variation 48 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777330048" variation 55 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777329779" variation 56 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1323733874" variation 59..88 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="caaatagcacttctgtcatgctggatgtca" /replace="caaatagcacttctgtcatgctggatgtcaaatagcacttctgtcatg ctggatgtca" /db_xref="dbSNP:1777326521" variation 59 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777329221" variation 60 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:3130931" variation 61 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107929" variation 67 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1223033686" variation 68 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1054562013" variation 70 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1371054306" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777328204" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggatgaagaacaag" /db_xref="dbSNP:1309830792" variation 74..75 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="atgaagaacaagtgccga" /replace="gccga" /db_xref="dbSNP:1409890798" variation 74 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777327959" variation 76 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:935889637" variation 77 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1308827226" variation 79 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777326787" variation 90 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777326233" variation 91 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:750002991" variation 94 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777325711" variation 95 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777325278" variation 101 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:979949563" variation 102 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1364491233" variation 103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777324518" variation 106 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:573550776" variation 107 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151107769" variation 114 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1300756432" variation 115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:76465289" variation 120 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777323508" variation 125 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1356944417" variation 126 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777322994" variation 127 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322739" variation 130 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322487" variation 132 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1229902923" variation 135 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:536581051" variation 136 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:983180480" variation 137 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1454069209" variation 139..141 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777320959" variation 142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1484264122" variation 144 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320435" variation 147 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320187" variation 151 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:769146675" variation 154 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:977786363" variation 156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1371506489" variation 162 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:566021008" variation 163 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777318676" variation 167 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1582037748" variation 171 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410508850" variation 172 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777317928" variation 176 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1173026294" variation 179 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749630858" variation 189 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777317122" variation 190 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:2151107559" variation 191 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1166012936" variation 192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:950476755" variation 193 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316548" variation 199 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107531" variation 201 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1184040360" variation 203 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316008" variation 206 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776087600" variation 221 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200340326" variation 222..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="atga" /replace="atgatga" /db_xref="dbSNP:67207605" variation 222 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1185683743" variation 223..224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="aag" /replace="tag" /db_xref="dbSNP:1777314586" variation 223 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:77085553" variation 224..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gag" /replace="gaggag" /db_xref="dbSNP:9281235" variation 224..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ga" /replace="gaaga" /replace="gacga" /db_xref="dbSNP:1777313779" variation 224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggag" /replace="gtgg" /db_xref="dbSNP:72545985" variation 225..228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="agta" /replace="agtagta" /db_xref="dbSNP:2151107394" variation 225..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agaag" /db_xref="dbSNP:141270342" variation 226..227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gat" /db_xref="dbSNP:1777312621" variation 226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gagg" /db_xref="dbSNP:1554135573" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="t" /db_xref="dbSNP:1372634738" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:201576321" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777312105" variation 228..229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gt" /db_xref="dbSNP:1561858807" variation 228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1432689419" variation 229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:553951373" variation 231 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1340775926" variation 233 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777310661" variation 234 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1483419984" variation 237 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777310112" variation 240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1450163111" variation 248 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1268187140" variation 249 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1208146203" variation 250 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:917183324" variation 256 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777308694" variation 258 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777308361" variation 260 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:991404678" variation 264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1238039827" variation 271 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:958551486" variation 274 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1314969939" variation 278 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1443317976" variation 279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1290134588" variation 280..284 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tgt" /replace="tgtgt" /db_xref="dbSNP:571828146" variation 280 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1240827545" variation 281 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:920402080" variation 283 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107235" variation 286 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151107222" variation 287 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:995080389" variation 289 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304963" variation 294 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:961733064" variation 295 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1014676128" variation 297 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107175" variation 299 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304114" variation 300..301 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="cc" /replace="ccc" /db_xref="dbSNP:1777303834" variation 302 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107154" variation 308 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1172171053" variation 313 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777303249" variation 314 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1402669669" variation 319 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777302766" variation 320 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1280756512" variation 321 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1388044631" variation 323 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:72856737" variation 328 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:868073649" variation 329 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151107091" variation 331 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:571668450" variation 333 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:759635638" variation 338 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107071" variation 340 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1368067216" variation 346 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1232121017" variation 348 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:545437201" variation 349 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:9263800" variation 355 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777299299" variation 356 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777299064" variation 357 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:11965454" variation 358 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777298772" variation 364 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107008" variation 365 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106995" variation 366 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1282835556" variation 367..369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aca" /db_xref="dbSNP:1429225310" variation 367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1464849350" variation 369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1473170859" variation 370 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777297246" variation 371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:893827576" variation 374 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250012422" variation 375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1467154259" variation 376 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777296078" variation 377 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777295791" variation 380..381 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cc" /db_xref="dbSNP:1198482935" variation 380 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777295522" variation 382..386 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tttt" /replace="ttttt" /db_xref="dbSNP:1378392227" variation 384 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777294937" variation 387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294345" variation 388 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294068" variation 394 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1478925844" variation 396 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777293504" variation 397 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1156581301" variation 400 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410882052" variation 404 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151106839" variation 407 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:567697919" variation 409 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1322418862" variation 416 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:3757349" variation 434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903306193" variation 440 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777291168" variation 443 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777290863" variation 448 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106776" variation 450 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:775390135" variation 451 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323876773" variation 453 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777289999" variation 455 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:905789598" variation 458..460 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gag" /db_xref="dbSNP:1777289394" variation 460..462 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gtg" /replace="gtgtg" /db_xref="dbSNP:1777289142" variation 466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:73401031" variation 468 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777288544" variation 477 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106706" variation 483 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151106697" variation 488 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106686" variation 489 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777288254" variation 494..499 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttcttt" /db_xref="dbSNP:550996676" variation 495..497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tct" /db_xref="dbSNP:1554135441" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1554135451" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777287697" variation 497..508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ttttttttt" /replace="tttttttttt" /replace="ttttttttttt" /replace="tttttttttttt" /replace="ttttttttttttt" /db_xref="dbSNP:rs9279005" variation 497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1204843522" variation 502 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:949924521" variation 504 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1463720016" variation 507 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1269728421" variation 508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:201876558" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777284056" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:200941459" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /db_xref="dbSNP:1322683938" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1209148552" variation 518..521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agag" /db_xref="dbSNP:776463063" variation 518 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1777282729" variation 521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1254214943" variation 526 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250844879" variation 527..530 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctct" /db_xref="dbSNP:1234752211" variation 529 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777281473" variation 531 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1161350339" variation 534 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777280491" variation 535 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777280177" variation 538 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:950118066" variation 540 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1457019029" variation 546 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:574609806" variation 547 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1582036271" variation 555 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1380101000" variation 556 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:983642581" variation 570 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1306970706" variation 575 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1582036200" variation 576 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777277431" variation 580 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1322911050" variation 581 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:929059992" variation 585 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777276499" variation 586 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777276066" variation 587 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:141017974" variation 588 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1300309753" variation 592 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777274980" variation 595 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777274684" variation 599 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1561857968" variation 604 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1582036092" variation 605 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777273790" variation 608 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:973063617" variation 609 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1582036067" variation 610 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:964318755" variation 611 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777272508" variation 625 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:151095308" variation 626 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777271795" variation 628 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582036011" variation 635 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777271173" variation 638 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777270899" variation 641 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1203311467" variation 642 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1483285873" variation 644 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777269970" variation 646 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1245688817" variation 649 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:961842977" variation 650 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1423175744" variation 651 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777268707" variation 654 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:907643738" variation 655 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777268123" variation 659 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:533115866" variation 661 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:954544116" variation 662..666 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tttt" /replace="ttttt" /db_xref="dbSNP:1561857858" variation 669 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1371755091" variation 674 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1167617089" variation 675 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777266300" variation 678 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1370782162" variation 683 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:779561772" variation 684 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777265399" variation 686 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:955078906" variation 687 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777264737" variation 692 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1377345590" variation 695 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1192583085" variation 697 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1314005077" variation 701 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1021109193" variation 706 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777263170" variation 718 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1028628180" variation 722 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777261934" variation 725 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1010088871" variation 726 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777261360" variation 728 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1297231507" variation 729 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:893908328" variation 732 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1207472601" variation 733 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1032397103" variation 734 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151105975" variation 736 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1460740055" variation 737 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1002211292" variation 744 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:562465318" variation 745 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1561857678" variation 755 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151105898" variation 757 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777258652" variation 759 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:770180344" variation 762 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:964250913" variation 763 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1242653526" variation 766 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1183137274" variation 768 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1440123342" variation 772 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1249038204" variation 773 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:3132526" variation 774 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1561857616" variation 779 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:573636729" variation 780 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777255462" variation 782 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1291997215" variation 783 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1247763647" variation 784 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:756964786" variation 785 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:949991822" variation 786 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1442835906" variation 789 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1337392829" variation 793 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777253665" variation 794 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777253402" variation 795 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777253136" variation 797 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151105737" variation 800 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1357816400" variation 801 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1326790090" variation 802..816 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="taaccttcataacct" /replace="taaccttcataaccttcataacct" /db_xref="dbSNP:1777250501" variation 802 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1408941217" variation 807 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1303980168" variation 808 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1365998522" variation 810 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777251361" variation 811 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777251095" variation 815 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777250801" variation 824 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:746682206" variation 825..828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ttct" /replace="ttcttct" /db_xref="dbSNP:67257409" variation 825..826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gc" /db_xref="dbSNP:28728473" variation 825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:777344152" variation 825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tgct" /db_xref="dbSNP:1561857487" variation 826..827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="atc" /replace="gtc" /replace="ttc" /db_xref="dbSNP:2151105584" variation 826..827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tc" /replace="tcctc" /db_xref="dbSNP:1554135249" variation 826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2070701153" variation 826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:71563310" variation 827..829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ctc" /replace="ctcctc" /db_xref="dbSNP:9281234" variation 827..828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctact" /replace="ctgct" /db_xref="dbSNP:2151105499" variation 827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cacc" /replace="cc" /replace="cccc" /replace="cgcc" /db_xref="dbSNP:rs1554135251" variation 828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777247687" variation 829..830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ctg" /replace="ctt" /db_xref="dbSNP:79966288" variation 829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="ctcc" /db_xref="dbSNP:1554135252" variation 830..831 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="tca" /replace="tcc" /db_xref="dbSNP:1159152310" variation 830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:752409659" variation 838 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1311441900" variation 839 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:561385932" variation 844..850 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tct" /replace="tctttct" /db_xref="dbSNP:1471206311" variation 844 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:765257293" variation 847 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1252825210" variation 848 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:868416189" variation 853 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1362514380" variation 858 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777243744" variation 860 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:754865454" variation 861 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1265163" variation 863 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1271554852" variation 867 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:920359564" variation 869 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777242610" variation 871 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151105316" variation 873 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1561857278" variation 875 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:973093406" variation 879 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777241739" variation 880 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777241468" variation 882 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777241192" variation 885 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1489760262" variation 886 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1189136114" variation 888 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777240374" variation 894..898 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1423998752" variation 896 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777240102" variation 897 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1288712416" variation 903 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1433024511" variation 904 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151105201" variation 907 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777238944" variation 908 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:572416729" variation 909 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:761916552" variation 913 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:910216174" variation 915 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:115513668" variation 918 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1456136909" variation 919 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1227753208" variation 935 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1345889080" variation 941 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:58535985" variation 942 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:58132172" variation 943 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427955524" variation 945 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777235654" variation 946 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1055684992" variation 954 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1304792735" variation 958 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1437341593" variation 960 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:954964862" variation 962 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1021600248" variation 963 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1292063532" variation 963 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777233811" variation 966 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:76364340" variation 971 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1349458032" misc_feature 974..976 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="upstream in-frame stop codon" variation 976 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1303151899" variation 981 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1319251305" variation 983 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:763461206" variation 987 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1405930812" variation 991 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1159041236" variation 996 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:958411387" variation 998 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1481081875" variation 1001 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:775689149" variation 1003 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1197635439" misc_feature 1004..1006 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="alternative start codon; OCT4B-265; polymorphic and non-functional in this RefSeq" variation 1005 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:3130932" variation 1007 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:746349953" variation 1008 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151104931" variation 1012 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1216104654" variation 1014 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:374060997" variation 1021 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:770437114" variation 1022 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1300240387" variation 1025 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777227576" variation 1026 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:751818073" variation 1028 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:777447714" variation 1029 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1285130324" variation 1030 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1221408916" variation 1032 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1366683434" variation 1037 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1270956235" variation 1038 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /db_xref="dbSNP:1343489733" variation 1038 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:748039347" variation 1041 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1320046736" variation 1045 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1470348977" variation 1048 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1192525392" variation 1054 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:9501063" variation 1055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1174939469" variation 1057 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1471798553" variation 1058 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:753723388" variation 1060 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151104758" variation 1062 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:780099361" variation 1063 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1159138802" variation 1064 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:374746302" variation 1068 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:751667986" variation 1069 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:764458539" variation 1072 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1187321294" variation 1074 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1461395860" variation 1078..1081 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ctgg" /db_xref="dbSNP:1162777202" variation 1078 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:72856736" variation 1080 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1207984449" variation 1081 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1561856622" variation 1085 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582033638" variation 1086 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1014613031" variation 1088 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:765521397" variation 1090 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777217414" variation 1091 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:759883550" variation 1094 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:777021724" variation 1095..1096 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="tt" /db_xref="dbSNP:1453409159" variation 1096 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:760230615" variation 1098 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1582033488" variation 1099 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:772698923" variation 1103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:771780451" variation 1106 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:747761780" variation 1108 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1355465893" variation 1115..1118 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aaa" /replace="aaaa" /db_xref="dbSNP:1175259104" variation 1115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777213682" variation 1121 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:778571821" variation 1125 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:768359010" variation 1128 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1489249310" variation 1129 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1387884870" variation 1132 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1167606498" variation 1135 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:749071230" variation 1136 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408966195" variation 1137 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1288972831" variation 1139 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244494688" variation 1140 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:149025884" variation 1142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1226467340" variation 1143 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:137936040" variation 1148 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777208385" variation 1156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:751745427" variation 1157 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:777993058" variation 1159 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1321757885" variation 1162 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:150320288" variation 1165 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1274145021" variation 1166 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151104326" variation 1174 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1561856346" variation 1180 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777205659" variation 1185 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777205330" variation 1192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1247046824" variation 1195 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1361655165" variation 1196 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1272018324" variation 1204 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777203896" variation 1210 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1313084641" variation 1213 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1395953191" variation 1214 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1374605227" variation 1222 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:752871883" variation 1225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1440419653" variation 1227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:910240285" CDS 1229..1801 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="isoform 2 is encoded by transcript variant 2; non-AUG (CUG) translation initiation codon; POU-type homeodomain-containing DNA-binding protein; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; octamer-binding protein 3; octamer-binding protein 4; octamer-binding transcription factor 3" /codon_start=1 /product="POU domain, class 5, transcription factor 1 isoform 2" /protein_id="NP_976034.4" /db_xref="CCDS:CCDS47398.2" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" /translation="
MGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"
misc_feature <1229..1354 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:451464" misc_feature 1307..1309 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="OCT4B-164; Region: Alternative start codon" misc_feature order(1409..1423,1427..1429,1478..1480,1496..1498, 1535..1537,1541..1546,1553..1558,1562..1570,1574..1579) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1415..1576 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(1415..1417,1424..1426,1544..1546,1553..1558, 1565..1567) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" variation 1236 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1307000564" variation 1240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582032778" variation 1241 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777200309" exon 1245..1375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1246 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754269967" variation 1250 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1329745808" variation 1252 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951425605" variation 1257 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298706028" variation 1264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:373808092" variation 1267 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777172331" variation 1270 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1362025857" variation 1273 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1290187689" variation 1275 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777171228" variation 1291 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1455194086" variation 1295 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777170549" variation 1300 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1387743881" variation 1302 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756413624" variation 1315 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777169354" variation 1318 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:115234511" variation 1319 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:768029325" variation 1320 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1037478772" variation 1324 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429404142" variation 1332 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151103219" variation 1345 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1341968669" variation 1350 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777167062" variation 1355 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1007322893" variation 1360 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777166338" variation 1364 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:572480837" variation 1365 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777165573" variation 1371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1186685294" variation 1373 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:773889469" variation 1375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:763710527" exon 1376..1534 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1377 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777140852" variation 1378 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777140477" variation 1379 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1441261772" variation 1380 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1256075529" variation 1383 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1196692240" variation 1387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1016182724" variation 1394 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1150767" variation 1396 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:780201728" variation 1397 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:750755680" variation 1402 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767958442" variation 1403 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1340827343" variation 1406 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1315221039" variation 1407 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246353090" variation 1410 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777135286" variation 1411 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1338565059" variation 1416 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1333452170" variation 1418 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777134129" variation 1423 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1391716274" variation 1424 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777133457" variation 1426 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151102295" variation 1429 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:757769384" variation 1434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1306384765" variation 1436 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429420206" variation 1437 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:751096375" variation 1438 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:368434272" variation 1440 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1471859282" variation 1441 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368353231" variation 1443 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777130443" variation 1444 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1183206781" variation 1445 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1052108705" variation 1447 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:578180451" variation 1462 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:775301501" variation 1466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1325738578" variation 1477 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:764939136" variation 1483 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:17851818" variation 1486 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951452940" variation 1487 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777126425" variation 1489 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776478147" variation 1497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1353681075" variation 1500 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:770844532" variation 1505 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777125291" variation 1507 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:746974556" variation 1516 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1352084514" variation 1520 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1286303728" variation 1521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408995142" variation 1522 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427351164" variation 1525 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:772966815" variation 1526 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:768746587" variation 1529 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749326531" variation 1530 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777122104" variation 1532 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1390168415" exon 1535..2065 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1535 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1188579160" variation 1536 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:770067555" variation 1537 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246075526" variation 1540 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777088374" variation 1541 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1208076129" variation 1542 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:746104715" variation 1543 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1384083039" variation 1545 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1280550252" variation 1546 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298955101" variation 1548 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:867664390" variation 1552 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:781212227" variation 1560 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1271010739" variation 1561 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1437313632" variation 1562 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777084166" variation 1564 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777083772" variation 1571 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777083413" variation 1572 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1363163301" variation 1577 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777082620" variation 1586 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:771345851" variation 1588 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:141766253" variation 1589 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778460021" variation 1593 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777081085" variation 1594 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1174320263" variation 1596 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:546320542" variation 1597..1601 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ac" /replace="acaac" /db_xref="dbSNP:765569430" variation 1599 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777079901" variation 1600 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1423969939" variation 1602 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:950764201" variation 1604 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1486650077" variation 1613 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:758948344" variation 1624 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777077666" variation 1626 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:752325450" variation 1628 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1189046873" variation 1637 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778574549" variation 1639 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1314271734" variation 1641 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1030266660" variation 1646 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1483497814" variation 1650 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974056564" variation 1651 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1480295008" variation 1654 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777074060" variation 1658 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1200837847" variation 1659 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:16897482" variation 1661 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777072975" variation 1662 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1207698528" variation 1663 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1432082123" variation 1664 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1441659931" variation 1669 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754481951" variation 1673 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230947193" variation 1678 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777070734" variation 1684 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:753553081" variation 1691 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:765910375" variation 1697 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777069475" variation 1699 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1246815764" variation 1702 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1158543431" variation 1705 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1374581600" variation 1711 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:997814201" variation 1714 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1301635040" variation 1717 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777067093" variation 1719 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:760558360" variation 1722 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1355522268" variation 1725 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:750163518" variation 1726 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767500519" variation 1727 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1387940273" variation 1730 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1016136973" variation 1737 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1038848905" variation 1738 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:761734933" variation 1742 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:986006262" variation 1744 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777063161" variation 1748 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1348560317" variation 1750 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:953270489" variation 1751 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1284370986" variation 1752 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1318153696" variation 1756 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:774206292" variation 1757..1759 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="cct" /db_xref="dbSNP:1777060496" variation 1757 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:769875118" variation 1760 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777060142" variation 1765 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061118" variation 1766 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1207558407" variation 1770 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061120" variation 1773 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:776940833" variation 1776 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1274211726" variation 1778 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1222340156" variation 1779 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777056973" variation 1780 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:771024256" variation 1782 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1223697753" variation 1788 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:747446765" variation 1796 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1191115401" variation 1802 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427929496" variation 1803 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:997296748" variation 1806 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:892230384" variation 1811 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1554134152" variation 1812 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:564148752" variation 1818 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1434585421" variation 1820..1821 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1408399482" variation 1821 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777052599" variation 1823..1827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1351162048" variation 1823 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368265136" variation 1825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1307060444" variation 1827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1457938687" variation 1829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1162581262" variation 1830..1831 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ag" /db_xref="dbSNP:1491028222" variation 1830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="a" /db_xref="dbSNP:1163021077" variation 1830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1554134128" variation 1830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:772503540" variation 1832 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:748680648" variation 1838 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777048797" variation 1840 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777048444" variation 1841 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903483977" variation 1842 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:779517517" variation 1845 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754549702" variation 1849 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1251306973" variation 1855 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777046704" variation 1857 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1061126" variation 1862 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777045960" variation 1867..1869 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:1777045583" variation 1870 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777045236" variation 1872 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1777044891" variation 1873 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1304742773" variation 1874 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151100101" variation 1876 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:3734864" variation 1877 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1409164251" variation 1878 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1189358100" variation 1879 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777042927" variation 1904 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1472556225" variation 1906 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1249631450" variation 1916 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1226100360" variation 1920 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777041453" variation 1926..1928 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aaa" /replace="aaaaa" /db_xref="dbSNP:60004964" variation 1926 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777041138" variation 1927 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200275741" variation 1931 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:917547918" variation 1935 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:896681857" variation 1946..1948 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:746543478" variation 1949..1952 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1777038521" variation 1950 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:938900222" variation 1952 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1482261391" variation 1953 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1057051690" variation 1955 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777037472" variation 1960 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1233955454" variation 1971 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777036766" variation 1982 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777036406" variation 1993 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:930130200" variation 2003 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:537327593" variation 2004 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1481698220" variation 2005 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1265122857" variation 2006 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777034633" variation 2009 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:927467930" variation 2012 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:980276667" variation 2013 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151099846" variation 2017 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777033427" variation 2018 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1388129250" variation 2020 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777032759" variation 2026..2033 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="taaa" /replace="taaataaa" /db_xref="dbSNP:1409128704" variation 2027..2029 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777032031" variation 2027 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323343063" regulatory 2028..2033 /regulatory_class="polyA_signal_sequence" /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="hexamer: AATAAA" variation 2031..2036 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaagaa" /db_xref="dbSNP:1777031252" variation 2037..2039 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gcc" /db_xref="dbSNP:750617181" variation 2038 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1313339858" variation 2039 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:13409" variation 2048 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1356217144" variation 2050 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777029217" variation 2054 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777028855" variation 2055..2057 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aga" /db_xref="dbSNP:1777028490" variation 2058 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:983923886" variation 2061 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1445660115" variation 2064 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974089105" polyA_site 2065 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="major polyA site" ORIGIN
ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacaggtgcgtgccaccgtgcccagctaatttttgtgtttttagtagagacggggtttcaccatgttggccatgctggtcttgaactcctgacctcgtgatctgcccacctcggcctcccaaagtgctggaattataggcgtgagccaccgcgcccagcaaagaacttctaaccttcataacctgacaggtgttctcgaggccagggtctctctttctgtcctttcacgatgctctgcatcccttggatgtgccagtttctgggggaagagtagtcctttgttacatgcatgagtcagtgaacagggaatgggtgaatgacatttgtgggtaggttatttctagaagttaggtgggcagcttggaaggcagaggcacttctacagactattccttggggccacacgtaggttcttgaatcccgaatggaaaggggagattgataactggtgtgtttatgttcttacaagtcttctgccttttaaaatccagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacactta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]