ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-04-19 09:00:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_005227 1254 bp mRNA linear PRI 17-DEC-2022
DEFINITION Homo sapiens ephrin A4 (EFNA4), transcript variant 1, mRNA.
ACCESSION NM_005227
VERSION NM_005227.3
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1254)
AUTHORS Yuan W, Zhao H, Zhou A and Wang S.
TITLE Interference of EFNA4 suppresses cell proliferation, invasion and
angiogenesis in hepatocellular carcinoma by downregulating PYGO2
JOURNAL Cancer Biol Ther 23 (1), 1-12 (2022)
PUBMED 36404439
REMARK GeneRIF: Interference of EFNA4 suppresses cell proliferation,
invasion and angiogenesis in hepatocellular carcinoma by
downregulating PYGO2.
REFERENCE 2 (bases 1 to 1254)
AUTHORS Kousathanas A, Pairo-Castineira E, Rawlik K, Stuckey A, Odhams CA,
Walker S, Russell CD, Malinauskas T, Wu Y, Millar J, Shen X,
Elliott KS, Griffiths F, Oosthuyzen W, Morrice K, Keating S, Wang
B, Rhodes D, Klaric L, Zechner M, Parkinson N, Siddiq A, Goddard P,
Donovan S, Maslove D, Nichol A, Semple MG, Zainy T, Maleady-Crowe
F, Todd L, Salehi S, Knight J, Elgar G, Chan G, Arumugam P, Patch
C, Rendon A, Bentley D, Kingsley C, Kosmicki JA, Horowitz JE, Baras
A, Abecasis GR, Ferreira MAR, Justice A, Mirshahi T, Oetjens M,
Rader DJ, Ritchie MD, Verma A, Fowler TA, Shankar-Hari M, Summers
C, Hinds C, Horby P, Ling L, McAuley D, Montgomery H, Openshaw PJM,
Elliott P, Walsh T, Tenesa A, Fawkes A, Murphy L, Rowan K, Ponting
CP, Vitart V, Wilson JF, Yang J, Bretherick AD, Scott RH, Hendry
SC, Moutsianas L, Law A, Caulfield MJ and Baillie JK.
CONSRTM GenOMICC investigators; 23andMe investigators; COVID-19 Human
Genetics Initiative
TITLE Whole-genome sequencing reveals host factors underlying critical
COVID-19
JOURNAL Nature 607 (7917), 97-103 (2022)
PUBMED 35255492
REFERENCE 3 (bases 1 to 1254)
AUTHORS Chen YL, Yen YC, Jang CW, Wang SH, Huang HT, Chen CH, Hsiao JR,
Chang JY and Chen YW.
TITLE Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
spheroid formation by upregulating NANOG expression in oral
squamous cell carcinoma cells
JOURNAL Sci Rep 11 (1), 644 (2021)
PUBMED 33436772
REMARK GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
migration and spheroid formation by upregulating NANOG expression
in oral squamous cell carcinoma cells.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1254)
AUTHORS Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
MA.
TITLE A reference map of the human binary protein interactome
JOURNAL Nature 580 (7803), 402-408 (2020)
PUBMED 32296183
REFERENCE 5 (bases 1 to 1254)
AUTHORS Flores MA, Fortea P, Trinidad EM, Garcia D, Soler G, Ortuno FJ,
Zapata AG and Alonso-Colmenar LM.
TITLE EphrinA4 plays a critical role in alpha4 and alphaL mediated
survival of human CLL cells during extravasation
JOURNAL Oncotarget 7 (30), 48481-48500 (2016)
PUBMED 27374180
REMARK GeneRIF: Study present for the first time in vitro and in vivo
evidence suggesting that the major role of two ephrin A4 isoforms
in chronic lymphocytic leukemia could be related with a
non-previously described mechanism of survival linked to
extravasation strongly dependent on integrin signaling.
REFERENCE 6 (bases 1 to 1254)
AUTHORS Zhou R.
TITLE The Eph family receptors and ligands
JOURNAL Pharmacol Ther 77 (3), 151-181 (1998)
PUBMED 9576626
REMARK Review article
REFERENCE 7 (bases 1 to 1254)
AUTHORS Flanagan JG and Vanderhaeghen P.
TITLE The ephrins and Eph receptors in neural development
JOURNAL Annu Rev Neurosci 21, 309-345 (1998)
PUBMED 9530499
REMARK Review article
REFERENCE 8 (bases 1 to 1254)
AUTHORS Gale NW, Holland SJ, Valenzuela DM, Flenniken A, Pan L, Ryan TE,
Henkemeyer M, Strebhardt K, Hirai H, Wilkinson DG, Pawson T, Davis
S and Yancopoulos GD.
TITLE Eph receptors and ligands comprise two major specificity subclasses
and are reciprocally compartmentalized during embryogenesis
JOURNAL Neuron 17 (1), 9-19 (1996)
PUBMED 8755474
REFERENCE 9 (bases 1 to 1254)
AUTHORS Cerretti DP, Lyman SD, Kozlosky CJ, Copeland NG, Gilbert DJ,
Jenkins NA, Valentine V, Kirstein MN, Shapiro DN and Morris SW.
TITLE The genes encoding the eph-related receptor tyrosine kinase ligands
LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
Epl4) are clustered on human chromosome 1 and mouse chromosome 3
JOURNAL Genomics 33 (2), 277-282 (1996)
PUBMED 8660976
REFERENCE 10 (bases 1 to 1254)
AUTHORS Kozlosky CJ, Maraskovsky E, McGrew JT, VandenBos T, Teepe M, Lyman
SD, Srinivasan S, Fletcher FA, Gayle RB 3rd, Cerretti DP et al.
TITLE Ligands for the receptor tyrosine kinases hek and elk: isolation of
cDNAs encoding a family of proteins
JOURNAL Oncogene 10 (2), 299-306 (1995)
PUBMED 7838529
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CD671399.1, BE780161.1,
AI459151.1 and BQ940212.1.
This sequence is a reference standard in the RefSeqGene project.
On Nov 22, 2018 this sequence version replaced NM_005227.2.
Summary: This gene encodes a member of the ephrin (EPH) family. The
ephrins and EPH-related receptors comprise the largest subfamily of
receptor protein-tyrosine kinases and have been implicated in
mediating developmental events, especially in the nervous system
and in erythropoiesis. Based on their structures and sequence
relationships, ephrins are divided into the ephrin-A (EFNA) class,
which are anchored to the membrane by a
glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
class, which are transmembrane proteins. This gene encodes an EFNA
class ephrin that has been implicated in proliferation and
metastasis of several types of cancers. [provided by RefSeq, May
2022].
Transcript Variant: This variant (1), also known as ephrin-A4 (m),
is the longest transcript and it encodes isoform a. Isoform a is a
membrane-bound protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: ERR279825.9236.1,
SRR1163658.260846.1 [ECO:0000332]
##Evidence-Data-END##
##RefSeq-Attributes-START##
coronavirus related :: locus in the vicinity of
disease-associated variant(s)
MANE Ensembl match :: ENST00000368409.8/ ENSP00000357394.3
RefSeq Select criteria :: based on conservation, expression
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-583 CD671399.1 10-592
584-1074 BE780161.1 141-631
1075-1249 AI459151.1 16-190 c
1250-1254 BQ940212.1 477-481
FEATURES Location/Qualifiers
source 1..1254
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21.3"
gene 1..1254
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="ephrin A4"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
exon 1..197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 1
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571648074"
variation 2
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1056175760"
variation 3
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:539593653"
variation 4
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:949761401"
variation 9
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1044174413"
variation 10
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:905998730"
variation 11
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:941502694"
variation 13..15
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1662879747"
variation 13
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464119917"
variation 14
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1002230"
variation 16
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571648146"
variation 17
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1170853712"
variation 18
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369610690"
variation 21..26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tc"
/replace="tctctc"
/db_xref="dbSNP:964695884"
variation 22
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1182087715"
variation 25
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102437167"
variation 26
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:897387079"
variation 28
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881223"
variation 29
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1558137938"
variation 30
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:994855515"
variation 32
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881720"
variation 34
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1433143254"
variation 35
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662881992"
variation 40
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662882112"
variation 41
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1322365129"
variation 42
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1365659493"
variation 43
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051079881"
variation 44
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1282376546"
variation 45
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1358327937"
variation 46..48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:1181310223"
variation 46
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662883179"
variation 48
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:955424484"
variation 49
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1228436701"
variation 52
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:750018113"
variation 53..62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gccaggccag"
/replace="gccaggccaggccag"
/db_xref="dbSNP:1253948957"
variation 53
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1463310416"
variation 54
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:958220768"
variation 55
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1248187187"
variation 59..60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1662884907"
variation 59
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1219973346"
variation 60
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:988198140"
variation 62
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:758048320"
variation 64
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779821500"
variation 67
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:914050693"
variation 69
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:946855865"
variation 71
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1163962401"
variation 73
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1411314602"
variation 75
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455908012"
variation 77
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:746766754"
variation 78
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662886993"
variation 84
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1043928491"
CDS 85..690
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="isoform a precursor is encoded by transcript
variant 1; ligand of eph-related kinase 4; eph-related
receptor tyrosine kinase ligand 4"
/codon_start=1
/product="ephrin-A4 isoform a precursor"
/protein_id="NP_005218.1"
/db_xref="CCDS:CCDS1089.1"
/db_xref="GeneID:1945"
/db_xref="HGNC:HGNC:3224"
/db_xref="MIM:601380"
/translation="
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL"
sig_peptide 85..159
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 160..594
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/product="Ephrin-A4. /id=PRO_0000008373"
/note="propagated from UniProtKB/Swiss-Prot (P52798.1)"
misc_feature 163..540
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="Ectodomain of Ephrin A; Region:
Ephrin-A_Ectodomain; cd10425"
/db_xref="CDD:259896"
misc_feature 181..183
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (P52798.1); glycosylation site"
misc_feature order(241..243,364..378,403..408,427..444,448..453)
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="receptor binding site [polypeptide binding]; other
site"
/db_xref="CDD:259896"
variation 85
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1662887221"
variation 87
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:754852081"
variation 88
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:926859436"
variation 89
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102437399"
variation 92
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:938282528"
variation 98
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1448650572"
variation 99
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1429093184"
variation 100
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102437421"
variation 101
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1278509153"
variation 107
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1326461416"
variation 108
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:780960543"
variation 109
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267248"
variation 112
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1403415249"
variation 113
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662888815"
variation 115
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:891128045"
variation 117
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:12760718"
variation 121
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1349674156"
variation 124
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006894326"
variation 125
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1322354491"
variation 126
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:111269205"
variation 132
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1662889826"
variation 133
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1254487338"
variation 134
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:868405546"
variation 137
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1444693034"
variation 138
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662890317"
variation 140
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:968141432"
variation 142
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:771087028"
variation 144
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1157743046"
variation 146
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:865897803"
variation 147
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:774589466"
variation 149
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1471660146"
variation 150
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1184386171"
variation 151
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662891331"
variation 152
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1413024884"
variation 153
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414009017"
variation 154
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:746026404"
variation 155
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:772406343"
variation 157
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1033285451"
variation 158
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662892512"
variation 159
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1197207739"
variation 161
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1232431969"
variation 163
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414753641"
variation 164
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1307352212"
variation 165
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1348498880"
variation 168
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1411162602"
variation 169
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1662893318"
variation 171
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:1558138217"
variation 175
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:896160038"
variation 176
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1662893722"
variation 177
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1288397903"
variation 178
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:543428198"
variation 181
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:993214956"
variation 183
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1230597690"
variation 186
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1254696715"
variation 187
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1347586578"
variation 188
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1201332848"
variation 189
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:760930080"
variation 190..191
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1662894831"
variation 192
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:764545146"
variation 194
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1227854348"
variation 195
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:776966466"
variation 197
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1290688935"
exon 198..484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 198
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054146"
variation 205
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1391062717"
variation 206
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:762225853"
variation 207
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663054383"
variation 211
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770282147"
variation 213
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773749190"
variation 214
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:745549912"
variation 216
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:146980401"
variation 217
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:142249822"
variation 226
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1242749612"
variation 227
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663054982"
variation 233
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1267281203"
variation 236
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927730429"
variation 237
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:369664889"
variation 238
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:767156779"
variation 242
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571653198"
variation 243
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:780175061"
variation 244
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1341898292"
variation 251
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1215432400"
variation 252..257
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tg"
/replace="tgtctg"
/db_xref="dbSNP:1466098975"
variation 259
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:752523859"
variation 261
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663055861"
variation 262
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:148289726"
variation 263
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:199992371"
variation 265
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1166365914"
variation 267
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:542869546"
variation 268
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:780190233"
variation 277
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:2102443103"
variation 278
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:370756589"
variation 279
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:781461644"
variation 280..284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/replace="ccccccc"
/db_xref="dbSNP:775997490"
variation 280
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199831867"
variation 281
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:199824664"
variation 282
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:773661006"
variation 283
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663057149"
variation 284
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553267556"
variation 285..289
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tgagg"
/db_xref="dbSNP:1663057416"
variation 285
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:764503763"
variation 286
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443149"
variation 288
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663057497"
variation 290
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240867561"
variation 294
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:763481245"
variation 295
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770278541"
variation 296
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:773922536"
variation 298
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:754285540"
variation 299
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201078911"
variation 300
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:541082385"
variation 309
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443179"
variation 310
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1266496575"
variation 313
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:138277393"
variation 314
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663058284"
variation 315
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:760519955"
variation 318
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1255181016"
variation 321
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774979817"
variation 324
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:753765092"
variation 326
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:368247612"
variation 327
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:778775987"
variation 328
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:997960767"
variation 329
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1179332137"
variation 330
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1244820785"
variation 331..333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tat"
/replace="tatat"
/db_xref="dbSNP:1413766725"
variation 333
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:370806650"
variation 334
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:201123791"
variation 335
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663059303"
variation 336
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102443247"
variation 338
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:200677884"
variation 340
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663059534"
variation 342
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464802967"
variation 344
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1359699711"
variation 345
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:375400864"
variation 347
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663060007"
variation 349
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060083"
variation 350
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="actcata"
/db_xref="dbSNP:1476256817"
variation 351
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663060334"
variation 352..353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:1168173419"
variation 353
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1431141714"
variation 354..358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ccccc"
/replace="cccccc"
/db_xref="dbSNP:758089508"
variation 354
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1004443861"
variation 356
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1407731922"
variation 358
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1558139918"
variation 359..361
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:766100897"
variation 359
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:142999275"
variation 362
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1409322528"
variation 364
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1286500741"
variation 365
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061730"
variation 366
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663061841"
variation 368
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663061959"
variation 369
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1352621818"
variation 370
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:778114973"
variation 371
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:749698866"
variation 372
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663062544"
variation 373
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1310232406"
variation 374..376
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1663062844"
variation 378
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1416250899"
variation 381
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:544929070"
variation 383..384
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="tt"
/db_xref="dbSNP:866104265"
variation 387
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:953962875"
variation 388..389
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="cctttcgctcc"
/db_xref="dbSNP:1663064354"
variation 388
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064257"
variation 391
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1280989380"
variation 399
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:774783548"
variation 403
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:989804173"
variation 405
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663064628"
variation 408
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064704"
variation 409
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663064781"
variation 411
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:563226989"
variation 416
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663064999"
variation 417
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:966768645"
variation 420
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1253329399"
variation 424
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:368795287"
variation 425
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:775247787"
variation 431
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422554226"
variation 432
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663065651"
variation 433
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:143886639"
variation 434
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663065922"
variation 439
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:776556253"
variation 440
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1256233082"
variation 444
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:761582524"
variation 445
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:765191806"
variation 447
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:750377879"
variation 450
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1372491408"
variation 456
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:114301457"
variation 459
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:767615043"
variation 460
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365701872"
variation 463..464
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1220776337"
variation 469
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067062"
variation 470
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:752848379"
variation 473
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1291203787"
variation 474
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1341436553"
variation 475
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663067363"
variation 476
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:756341656"
variation 477
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:778025181"
variation 479
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663067981"
variation 480
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102443491"
variation 482
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1437922306"
variation 484
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663068132"
exon 485..553
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 485
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1213932996"
variation 486
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:151179474"
variation 487
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663077376"
variation 492
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:41264287"
variation 493
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1464742957"
variation 499
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1187019544"
variation 501
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:764267914"
variation 506
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201670234"
variation 509
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102443869"
variation 513
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:757589642"
variation 515
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663077888"
variation 517
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:141223577"
variation 519
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:908106668"
variation 521
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746332488"
variation 522
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:142288768"
variation 525
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1463020576"
variation 528
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663078385"
variation 530
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663078450"
variation 534..536
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:1241165316"
variation 534
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663078516"
variation 535
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780776065"
variation 537
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:746489131"
variation 538
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1447360049"
variation 539
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:768333356"
variation 547
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780848551"
exon 554..1254
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/inference="alignment:Splign:2.1.0"
variation 555
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:199918580"
variation 560
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571655383"
variation 568
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:768509605"
variation 569
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1558140980"
variation 572
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1364547456"
variation 574
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:749049587"
variation 575
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:947930391"
variation 576
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1377253307"
variation 577
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1227349220"
variation 578
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:770758406"
variation 581
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1316953642"
variation 582
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1306944399"
variation 584
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1368166854"
variation 587
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1392568046"
variation 591
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:532664020"
variation 592
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1330109316"
variation 593
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:544709911"
variation 595
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:369650636"
variation 596
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1350761562"
variation 599
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:373255071"
variation 608
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:776565011"
variation 610
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:762021782"
variation 611
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:765348941"
variation 612
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1558141034"
variation 613..619
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="gggggg"
/replace="ggggggg"
/replace="gggggggg"
/db_xref="dbSNP:754580525"
variation 613
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:750724541"
variation 614
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:763362644"
variation 615
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:766881827"
variation 617
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1345844365"
variation 618
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1382173375"
variation 619
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:755453194"
variation 620
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:768127638"
variation 621
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1454499610"
variation 622
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:148918689"
variation 623
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:755687996"
variation 625
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:562789584"
variation 627
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:777266611"
variation 630
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:748959343"
variation 631
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:757001752"
variation 632
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:201292405"
variation 633
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:778681147"
variation 634
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:377230773"
variation 636
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1425095316"
variation 639
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:745724420"
variation 642
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:771903489"
variation 645
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:775539887"
variation 646
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:887728687"
variation 647
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663117107"
variation 651
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:941684493"
variation 660
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:202221214"
variation 664
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663117295"
variation 665..666
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:1355994737"
variation 667
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:142837088"
variation 669
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1255054162"
variation 670
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:769941477"
variation 671
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:200331554"
variation 672..677
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tct"
/replace="tcttct"
/db_xref="dbSNP:1663117807"
variation 674
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:145129032"
variation 679
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:760012398"
variation 680
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:759971147"
variation 683..684
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:748031667"
variation 683
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663118121"
variation 684
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1455877691"
variation 686..689
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="tg"
/replace="tgtg"
/db_xref="dbSNP:1166665924"
variation 687
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:753295258"
variation 689..691
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gag"
/db_xref="dbSNP:756079308"
variation 691
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663118493"
variation 698
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1320275678"
variation 701..702
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="cc"
/db_xref="dbSNP:760995989"
variation 701
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1384413083"
variation 702
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:199947288"
variation 706
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1339957778"
variation 707..711
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ctc"
/replace="ctctc"
/db_xref="dbSNP:1558141164"
variation 707
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1017969863"
variation 709
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:567168153"
variation 710
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102445596"
variation 711
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1553267703"
variation 714
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:201215681"
variation 716
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:758266087"
variation 717
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663119483"
variation 722
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:779807669"
variation 724
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:202246914"
variation 725
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:773440754"
variation 727
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="a"
/db_xref="dbSNP:749132073"
variation 727
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663119892"
variation 728
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1558141212"
variation 729..736
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="tcctccca"
/db_xref="dbSNP:771046983"
variation 731
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663120130"
variation 736
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:749435869"
variation 737
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:771274591"
variation 744..745
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ca"
/db_xref="dbSNP:774703301"
variation 745
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="t"
/db_xref="dbSNP:1558141229"
variation 745
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:774753006"
variation 749
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663120523"
variation 751
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1553267706"
variation 752..753
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:746080148"
variation 756
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:759796184"
variation 760
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1472051023"
variation 762
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1158978226"
variation 763
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:767943701"
variation 766
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455615031"
variation 767
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:889300332"
variation 771
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:775818108"
variation 773
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1170496887"
variation 776..780
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ggggg"
/replace="gggggg"
/db_xref="dbSNP:772130989"
variation 781
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1402072773"
variation 782
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445698"
variation 785..786
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aa"
/db_xref="dbSNP:775733013"
variation 786
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571655799"
variation 789
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:761244893"
variation 790
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:763533997"
variation 793
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663121737"
variation 794
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1228015744"
variation 795
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1021875220"
variation 797
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:748113318"
variation 799
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663122081"
variation 803..804
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1216183664"
variation 804
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663122196"
variation 809
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:772048174"
variation 814
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1484635748"
variation 818
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:761356922"
variation 820
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:552355758"
variation 821
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1031690866"
variation 823
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:960070810"
variation 827
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:750115905"
variation 833
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:758090033"
variation 844
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:916014726"
variation 845
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1472197427"
variation 846
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:779905284"
variation 847
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1421280494"
variation 849
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1553267728"
variation 850
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1160251060"
variation 852
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:570670486"
variation 855
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:915184543"
variation 857
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1314920375"
variation 862
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123547"
variation 863
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1158480020"
variation 864
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:2102445821"
variation 865
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663123675"
variation 869
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1558141354"
variation 874..880
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aaga"
/replace="aagaaga"
/db_xref="dbSNP:761223567"
variation 875
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1409227720"
variation 882
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:751395056"
variation 886
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663124021"
variation 888
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1375754714"
variation 891
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1204969278"
variation 892
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:754953222"
variation 893
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:781344227"
variation 897
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1345719917"
variation 899
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:749345800"
variation 901..904
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ct"
/replace="ctct"
/db_xref="dbSNP:1226859582"
variation 901
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1382096108"
variation 913
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1280886339"
variation 914
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:771183074"
variation 915
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:779226711"
variation 917
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663124751"
variation 918
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:746129864"
variation 920
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1057273721"
variation 923..927
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aca"
/replace="acaca"
/db_xref="dbSNP:764734484"
variation 926
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125039"
variation 930
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:981034397"
variation 931
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:909117055"
variation 932
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125260"
variation 934
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1162226299"
variation 940
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1404452992"
variation 945
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102445922"
variation 952
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897335499"
variation 953
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571655973"
variation 957
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:941954387"
variation 965
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:112399433"
variation 966
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571655986"
variation 967
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663125748"
variation 968
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125800"
variation 976..977
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="ct"
/db_xref="dbSNP:1237514676"
variation 976
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663125846"
variation 977
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:888731911"
variation 978
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:538384115"
variation 979
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1006507102"
variation 995
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:144763497"
variation 999
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126180"
variation 1001
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1219627836"
variation 1002
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663126295"
variation 1003
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1359075712"
variation 1008
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1292506153"
variation 1011
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:2102445976"
variation 1013
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663126528"
variation 1014
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1348896353"
variation 1019
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1213257771"
variation 1020
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1283668970"
variation 1022
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663126882"
variation 1026
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1487835650"
variation 1030
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127059"
variation 1032
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:897500547"
variation 1035
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663127195"
variation 1038
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:563813867"
variation 1040
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:773104614"
variation 1041
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:2102446017"
variation 1042
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663127485"
variation 1042
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1051454441"
variation 1043
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:374633006"
variation 1045
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663127614"
variation 1049
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1365820826"
variation 1055
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1164880029"
variation 1056
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1417352065"
variation 1061..1069
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="aagaag"
/replace="aagaagaag"
/db_xref="dbSNP:1379195799"
variation 1063
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:888902933"
variation 1067
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:956725684"
variation 1070..1072
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:989364734"
variation 1071
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1007708289"
variation 1072..1073
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="aggct"
/db_xref="dbSNP:1663128192"
variation 1074
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1190413930"
variation 1076
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1022239988"
variation 1079
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1455348952"
variation 1085
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:969296951"
variation 1087
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1663128555"
variation 1088
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:904745993"
variation 1093
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1224767589"
variation 1095
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663128731"
variation 1102
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1487333217"
variation 1106
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:759728514"
variation 1112
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1156430098"
variation 1116
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="g"
/db_xref="dbSNP:1663129224"
variation 1116
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:564877955"
variation 1119
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129286"
variation 1124
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129334"
variation 1128
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240377298"
variation 1129
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1319327545"
variation 1133
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:1663129495"
variation 1134
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129542"
variation 1136
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:775819390"
variation 1137..1140
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="actt"
/db_xref="dbSNP:1223300097"
variation 1137
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:927294280"
variation 1138
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:1663129834"
variation 1146
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663129924"
variation 1147
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1304546371"
variation 1148
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130022"
variation 1155
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:769750020"
variation 1156..1157
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1663130253"
variation 1156
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:536226496"
variation 1167
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130312"
variation 1184
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1455222047"
variation 1188
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130422"
variation 1189
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1375872284"
variation 1198
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057458627"
variation 1199
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663130596"
variation 1202
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130642"
variation 1203
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:554241024"
variation 1206
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1663130752"
variation 1208
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130822"
variation 1209
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1175030350"
variation 1210
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663130949"
variation 1211
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1480659387"
variation 1215
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131048"
variation 1216
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="g"
/db_xref="dbSNP:573097675"
regulatory 1221..1226
/regulatory_class="polyA_signal_sequence"
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="hexamer: AATAAA"
variation 1221
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1663131335"
variation 1222
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/db_xref="dbSNP:1663131390"
variation 1223
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="t"
/db_xref="dbSNP:930126542"
variation 1224
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1476999346"
variation 1227
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="c"
/replace="t"
/db_xref="dbSNP:1261129343"
variation 1235
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace=""
/replace="c"
/db_xref="dbSNP:1663131754"
variation 1237
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="g"
/replace="t"
/db_xref="dbSNP:1663131849"
variation 1239..1244
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="ttg"
/replace="ttgttg"
/db_xref="dbSNP:1663131940"
variation 1251
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:540427499"
polyA_site 1254
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/note="major polyA site"
variation 1254
/gene="EFNA4"
/gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
/replace="a"
/replace="g"
/db_xref="dbSNP:1325361549"
ORIGIN
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtcagcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacactcccagccccctctgtctcttgctattactgctgcttctgattcttcgtcttctgcgaattctgtgagccaagcagaccttccctctcatcccaaggagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]