2025-04-24 10:26:39, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001425142 2668 bp mRNA linear PRI 10-DEC-2024 DEFINITION Homo sapiens SIX homeobox 1 (SIX1), transcript variant 2, mRNA. ACCESSION NM_001425142 XM_017021602 XM_054376625 VERSION NM_001425142.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2668) AUTHORS Huang,S., Hu,J., Hu,M., Hou,Y., Zhang,B., Liu,J., Liu,X., Chen,Z. and Wang,L. TITLE Cooperation between SIX1 and DHX9 transcriptionally regulates integrin-focal adhesion signaling mediated metastasis and sunitinib resistance in KIRC JOURNAL Oncogene 43 (39), 2951-2969 (2024) PUBMED 39174859 REMARK GeneRIF: Cooperation between SIX1 and DHX9 transcriptionally regulates integrin-focal adhesion signaling mediated metastasis and sunitinib resistance in KIRC. REFERENCE 2 (bases 1 to 2668) AUTHORS Zhang,P., Zhang,W., Wang,X., Li,L., Lin,Y., Wu,N., Mao,R., Lin,J., Kang,M. and Ding,C. TITLE BCLAF1 drives esophageal squamous cell carcinoma progression through regulation of YTHDF2-dependent SIX1 mRNA degradation JOURNAL Cancer Lett 591, 216874 (2024) PUBMED 38636894 REMARK GeneRIF: BCLAF1 drives esophageal squamous cell carcinoma progression through regulation of YTHDF2-dependent SIX1 mRNA degradation. REFERENCE 3 (bases 1 to 2668) AUTHORS Guo,L., Li,F., Liu,H., Kong,D., Chen,C. and Sun,S. TITLE SIX1 amplification modulates stemness and tumorigenesis in breast cancer JOURNAL J Transl Med 21 (1), 866 (2023) PUBMED 38031089 REMARK GeneRIF: SIX1 amplification modulates stemness and tumorigenesis in breast cancer. Publication Status: Online-Only REFERENCE 4 (bases 1 to 2668) AUTHORS Stevenson,M.J., Phanor,S.K., Patel,U., Gisselbrecht,S.S., Bulyk,M.L. and O'Brien,L.L. TITLE Altered binding affinity of SIX1-Q177R correlates with enhanced WNT5A and WNT pathway effector expression in Wilms tumor JOURNAL Dis Model Mech 16 (11) (2023) PUBMED 37815464 REMARK GeneRIF: Altered binding affinity of SIX1-Q177R correlates with enhanced WNT5A and WNT pathway effector expression in Wilms tumor. REFERENCE 5 (bases 1 to 2668) AUTHORS Salam,A.A., Hafner,F.M., Linder,T.E., Spillmann,T., Schinzel,A.A. and Leal,S.M. TITLE A novel locus (DFNA23) for prelingual autosomal dominant nonsyndromic hearing loss maps to 14q21-q22 in a Swiss German kindred JOURNAL Am J Hum Genet 66 (6), 1984-1988 (2000) PUBMED 10777717 REFERENCE 6 (bases 1 to 2668) AUTHORS Ford,H.L., Kabingu,E.N., Bump,E.A., Mutter,G.L. and Pardee,A.B. TITLE Abrogation of the G2 cell cycle checkpoint associated with overexpression of HSIX1: a possible mechanism of breast carcinogenesis JOURNAL Proc Natl Acad Sci U S A 95 (21), 12608-12613 (1998) PUBMED 9770533 REFERENCE 7 (bases 1 to 2668) AUTHORS Boucher,C.A., Carey,N., Edwards,Y.H., Siciliano,M.J. and Johnson,K.J. TITLE Cloning of the human SIX1 gene and its assignment to chromosome 14 JOURNAL Genomics 33 (1), 140-142 (1996) PUBMED 8617500 REFERENCE 8 (bases 1 to 2668) AUTHORS Oliver,G., Wehr,R., Jenkins,N.A., Copeland,N.G., Cheyette,B.N., Hartenstein,V., Zipursky,S.L. and Gruss,P. TITLE Homeobox genes and connective tissue patterning JOURNAL Development 121 (3), 693-705 (1995) PUBMED 7720577 REFERENCE 9 (bases 1 to 2668) AUTHORS Shearer,A.E., Hildebrand,M.S., Odell,A.M. and Smith,R.J.H. TITLE Genetic Hearing Loss Overview JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE and Amemiya A (Eds.); GENEREVIEWS(R); (1993) PUBMED 20301607 REFERENCE 10 (bases 1 to 2668) AUTHORS Smith,R.J.H. TITLE Branchiootorenal Spectrum Disorder JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE and Amemiya A (Eds.); GENEREVIEWS(R); (1993) PUBMED 20301554 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL049874.3. On or before Oct 28, 2023 this sequence version replaced XM_017021602.3, XM_054376625.1. Summary: The protein encoded by this gene is a homeobox protein that is similar to the Drosophila 'sine oculis' gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene are a cause of autosomal dominant deafness type 23 (DFNA23) and branchiootic syndrome type 3 (BOS3). [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR14038194.997942.1, SRR14038197.148049.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968832, SAMEA1968968 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-789 AL049874.3 139852-140640 c 790-2668 AL049874.3 135862-137740 c FEATURES Location/Qualifiers source 1..2668 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="14" /map="14q23.1" gene 1..2668 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="SIX homeobox 1" /db_xref="GeneID:6495" /db_xref="HGNC:HGNC:10887" /db_xref="MIM:601205" exon 1..789 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /inference="alignment:Splign:2.1.0" misc_feature 187..189 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="upstream in-frame stop codon" CDS 289..810 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="isoform 2 is encoded by transcript variant 2; homeobox protein SIX1; sine oculis homeobox homolog 1" /codon_start=1 /product="homeobox protein SIX1 isoform 2" /protein_id="NP_001412071.1" /db_xref="GeneID:6495" /db_xref="HGNC:HGNC:10887" /db_xref="MIM:601205" /translation="
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQGEHRKQ"
misc_feature 313..642 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="Transcriptional regulator, SIX1, N-terminal SD domain; Region: SIX1_SD; pfam16878" /db_xref="CDD:465293" misc_feature 712..>789 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cl00084" /db_xref="CDD:469608" exon 790..2668 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /inference="alignment:Splign:2.1.0" regulatory 2076..2081 /regulatory_class="polyA_signal_sequence" /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="hexamer: ATTAAA" polyA_site 2097 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="major polyA site" regulatory 2645..2650 /regulatory_class="polyA_signal_sequence" /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" /note="hexamer: ATTAAA" polyA_site 2668 /gene="SIX1" /gene_synonym="BOS3; DFNA23; TIP39" ORIGIN
aagttccccggcaactagcagcatccaccgggcgggaggtcggaggcagcaaggccttaaaggctactgagtgcgccggccgttccgtgtccagaacctcccctactcctccgccttctcttccttggccgcccaccgccaagttccgactccggttttcgcctttgcaaagcctaaggaggaggttaggaacagccgcgcccccctccctgcggccgccgccccctgcctctcggctctgctccctgccgcgtgcgcctgggccgtgcgccccggcaggccccagccatgtcgatgctgccgtcgtttggctttacgcaggagcaagtggcgtgcgtgtgcgaggttctgcagcaaggcggaaacctggagcgcctgggcaggttcctgtggtcactgcccgcctgcgaccacctgcacaagaacgagagcgtactcaaggccaaggcggtggtcgccttccaccgcggcaacttccgtgagctctacaagatcctggagagccaccagttctcgcctcacaaccaccccaaactgcagcaactgtggctgaaggcgcattacgtggaggccgagaagctgcgcggccgacccctgggcgccgtgggcaaatatcgggtgcgccgaaaatttccactgccgcgcaccatctgggacggcgaggagaccagctactgcttcaaggagaagtcgaggggtgtcctgcgggagtggtacgcgcacaatccctacccatcgccgcgtgagaagcgggagctggccgaggccaccggcctcaccaccacccagggagaacaccgaaaacaataactcctcctccaacaagcagaaccaactctctcctctggaagggggcaagccgctcatgtccagctcagaagaggaattctcacctccccaaagtccagaccagaactcggtccttctgctgcagggcaatatgggccacgccaggagctcaaactattctctcccgggcttaacagcctcgcagcccagtcacggcctgcagacccaccagcatcagctccaagactctctgctcggccccctcacctccagtctggtggacttggggtcctaagtggggagggactggggcctcgaagggattcctggagcagcaaccactgcagcgactagggacacttgtaaatagaaatcaggaacatttttgcagcttgtttctggagttgtttgcgcataaaggaatggtggactttcacaaatatctttttaaaaatcaaaaccaacagcgatctcaagcttaatctcctcttctctccaactctttccacttttgcattttccttcccaatgcagagatcagggaaaaaaaaaaaaaaaaacccaaacaaacaaaagcacccaggcacccagtctgagttctgggcaactgatacgcctgtttcagcagcctttcttttttttcaatgaatgggaattgcaaatcaactggattttcattatttccttttaatttatatatggagaaatgtgaagagggaaaggaaatggaaagagaaagagaaagggagataaaaatagtgaaaataagagcctccaggctcagaagaactgattacattcttaaggtgaacaggaaaaatacaatctataactttctttgatgaggaaaaattaagtttacatttttcatatttagtgttaaacaatttaatgtagattaaaataaaagaccagtattaggaggaaaaaacaagtgcctaaatgtcttaatgctctctatgtgagacagaaatagacgtgaccattagtaatgcaactatttttgtcaaatttagtgggattttttggttgttgtttgttttcttgggttttttttttttaaatgacaaactctaaaaatgtaccaatgtgaaaaaacactttcctgaatgccattactcatgccctcaaagctttcatatctgtagcctactcctgtaaagggtttctcctgtttctagtttctagtttgcaaaggtatgccaacgaatctggcaacctggtatttgttactaaaacagcatgtgttttcaggtttcttttctattgtacctaaagcagtctaaattaaaacttagtagaacaccaggagtatgattctgtttctgaaaggtgagtggtgtattgctgtcattgggccctatttttttttttaaatatatttttctttcttacttaatggtggctgtgaattgcagggtactttgaaggccatcatctgaaccaagagtagtaactagattaattatatgacagaaagagtgaatttagccttggggtatttattaacttctattatttagatatgcaattttgtttaccactatctcttcacagcattcatatgttaactaagctcttttgtgttaacaagtttatgacaagactgtgaaagtaaaaataatttatctgcttgaagacaaaaaagggaaggagaacaaggatagaaacattgtgaattaatttgtacaaatagaaagcagaccagcaggacaggagctcttttgcagtgctgccggatggtgtctagaaaaatcccagtaatcatgtaggctccatattatttttgcctggggcaaaatgatgtatcttctgtatttagcttttaaaattagtgaaacaaatggcattatttattaaaattctactcaggataaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]