2025-04-24 10:23:00, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001412134 2607 bp mRNA linear PRI 13-JUN-2024 DEFINITION Homo sapiens calcium voltage-gated channel auxiliary subunit gamma 7 (CACNG7), transcript variant 3, mRNA. ACCESSION NM_001412134 VERSION NM_001412134.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2607) AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W., Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B., Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A., Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A., Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C., Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M., Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G., Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S., Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A., Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S., Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N., Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A., Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M., Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J., Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P., Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J., Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 2607) AUTHORS Yang,L., Katchman,A., Morrow,J.P., Doshi,D. and Marx,S.O. TITLE Cardiac L-type calcium channel (Cav1.2) associates with gamma subunits JOURNAL FASEB J 25 (3), 928-936 (2011) PUBMED 21127204 REFERENCE 3 (bases 1 to 2607) AUTHORS Kato,A.S., Gill,M.B., Ho,M.T., Yu,H., Tu,Y., Siuda,E.R., Wang,H., Qian,Y.W., Nisenbaum,E.S., Tomita,S. and Bredt,D.S. TITLE Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins JOURNAL Neuron 68 (6), 1082-1096 (2010) PUBMED 21172611 REFERENCE 4 (bases 1 to 2607) AUTHORS Chen,R.S., Deng,T.C., Garcia,T., Sellers,Z.M. and Best,P.M. TITLE Calcium channel gamma subunits: a functionally diverse protein family JOURNAL Cell Biochem Biophys 47 (2), 178-186 (2007) PUBMED 17652770 REMARK Review article REFERENCE 5 (bases 1 to 2607) AUTHORS Moss,F.J., Viard,P., Davies,A., Bertaso,F., Page,K.M., Graham,A., Canti,C., Plumpton,M., Plumpton,C., Clare,J.J. and Dolphin,A.C. TITLE The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression JOURNAL EMBO J 21 (7), 1514-1523 (2002) PUBMED 11927536 REFERENCE 6 (bases 1 to 2607) AUTHORS Chu,P.J., Robertson,H.M. and Best,P.M. TITLE Calcium channel gamma subunits provide insights into the evolution of this gene family JOURNAL Gene 280 (1-2), 37-48 (2001) PUBMED 11738816 REFERENCE 7 (bases 1 to 2607) AUTHORS Burgess,D.L., Gefrides,L.A., Foreman,P.J. and Noebels,J.L. TITLE A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family JOURNAL Genomics 71 (3), 339-350 (2001) PUBMED 11170751 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CP068259.2. Summary: The protein encoded by this gene is a type II transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members, a type I TARP and a calcium channel gamma subunit. [provided by RefSeq, Dec 2010]. Transcript Variant: This variant (3) uses the same exon combination as variant 2 but represents the allele encoded by the T2T-CHM13v2.0 genome assembly. The encoded isoform (3) has a frameshifted C-terminus compared to isoform 2. ##Evidence-Data-START## Transcript exon combination :: SRR3476690.731164.1, ERR4352442.554364.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA2154665, SAMEA2157437 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-240 CP068259.2 56988984-56989223 241-465 CP068259.2 56992509-56992733 466-552 CP068259.2 56994206-56994292 553-693 CP068259.2 56995071-56995211 694-2607 CP068259.2 57020529-57022442 FEATURES Location/Qualifiers source 1..2607 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.42" gene 1..2607 /gene="CACNG7" /note="calcium voltage-gated channel auxiliary subunit gamma 7" /db_xref="GeneID:59284" /db_xref="HGNC:HGNC:13626" /db_xref="MIM:606899" exon 1..240 /gene="CACNG7" /inference="alignment:Splign:2.1.0" misc_feature 51..53 /gene="CACNG7" /note="upstream in-frame stop codon" exon 241..465 /gene="CACNG7" /inference="alignment:Splign:2.1.0" CDS 270..1079 /gene="CACNG7" /note="isoform 3 is encoded by transcript variant 3; neuronal voltage-gated calcium channel gamma-7 subunit; voltage-dependent calcium channel gamma-7 subunit; TARP gamma-7; transmembrane AMPAR regulatory protein gamma-7; calcium channel, voltage-dependent, gamma subunit 7" /codon_start=1 /product="voltage-dependent calcium channel gamma-7 subunit isoform 3" /protein_id="NP_001399063.1" /db_xref="GeneID:59284" /db_xref="HGNC:HGNC:13626" /db_xref="MIM:606899" /translation="
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFILSGGRRDVRVPVHQALRGGGDVPSTPGLLPPASQRLLRLLGPVPAARGVAPRPEPLRHLQRRVHPNDAELPSRHQVPGPPAHLHLALLRPAPRSSPCLLLLLVLGGLPAMQRPLPSSGLLAPTRRRLRQL"
misc_feature 291..353 /gene="CACNG7" /note="propagated from UniProtKB/Swiss-Prot (P62955.1); transmembrane region" misc_feature 321..>698 /gene="CACNG7" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" misc_feature 576..638 /gene="CACNG7" /note="propagated from UniProtKB/Swiss-Prot (P62955.1); transmembrane region" exon 466..552 /gene="CACNG7" /inference="alignment:Splign:2.1.0" exon 553..693 /gene="CACNG7" /inference="alignment:Splign:2.1.0" exon 694..2607 /gene="CACNG7" /inference="alignment:Splign:2.1.0" regulatory 2353..2358 /regulatory_class="polyA_signal_sequence" /gene="CACNG7" /note="hexamer: AATAAA" polyA_site 2374 /gene="CACNG7" /note="major polyA site" regulatory 2578..2583 /regulatory_class="polyA_signal_sequence" /gene="CACNG7" /note="hexamer: AATAAA" polyA_site 2607 /gene="CACNG7" ORIGIN
agtagccaatgagcggccgccggttcctgctcccggctccgtccgccgagtgaggccgcggccgcggggggtggggggtgggaggccgggagggggccgggacgccgggctccggggcgggggcggggggcgcgggcaccggcgaccccggtggcggcggcggcggccgggggaagcctcggggccggtcatgcggctgcggggcccgcggcccggagcgtccgcccagccctgagcgaggccccgcagggcgccccctgcctctgaggatgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgtttggtgcgtgtggcctgctcctggtaggcatcgcggtcagcactgactactggctgtacatggaagaaggcacagtgctaccgcagaaccagaccaccgaggtcaagatggccctgcacgccggcctctggcgagtctgcttctttgcaggtcgggagaaaggtcgctgtgtggcctcagaatattttcttgaaccggagatcaatttggtgacggaaaacacggagaatattctgaagacagtgcgcacggccacccccttccccatggtcagcctcttcctcgtgttcacggccttcgtcatcagcaacatcggccacatccgcccgcagaggaccattctggcttttgtctctggcatcttcttcatactatcggggggccggcgtgatgtccgtgtacctgttcaccaagcgctacgcggaggaggagatgtaccgtccacacccggccttctaccgcccgcgtctcagcgactgctccgactactcgggccagttcctgcagcccgaggcgtggcgccgcggccggagcccctccgacatctccagcgacgtgtccatccaaatgacgcagaactaccctcccgccatcaagtacccggaccacctgcacatctccacctcgccctgctgaggcccgcccctcggagctccccctgcctcctcctcctcctcgtcttagggggtctccctgcaatgcagcgcccccttccgtcctcgggactcctcgctcccacccggaggaggctgcgccagctttaggccccgccctcctcccaatggctccgcccacagactcccttatttcaatggccgcgccctcttttcccgacctctccttttcattggtccctctcactcccaaatgactcctccccttcgttggcccgcccctttcctctggcccctcctctccaagaaaattagctcctccctcgttctccacctgctctgagctgggagcagccagaggcggtgcaagcgcccagctccccagagctccccaacctcggacctcaccgcaggggcgctgggctggagagcaggttcgggcagccgtcgggaataccgaccatcctcttctcccttctaacctgggcttcctttttccctgcctaatctcacctcctgacctgctgggtcctccggtgcagtgggagggccggcttgctccacccgcagccccggggtggcgtagggaagggggctggaagccacgggtacggttaacctggcccttccctccccatctcccctacttccctggaaggtcccattctttctcaccggctgggctcttttctgcttcctgaaggttacctgccttttagggggctcttgtctaaaggatcttcttgctttctcagctatccttggcttctttttcgtcttcctcctcctttaactctttctctcctttcctcccttcacccgttcgtcccaagcccttgggtgcatcccgccctaggcgcacaccagacggccagaatggggaccctagggtggagggaattcccccacgccatctccgcacctgtgcccgcctctcccccctcgaggccccgtcgagggagggaggggcagtagcgggggtcgacaccccccccaaacctctaagtcttccattttctggctctcctcctcattgacgtccctcttcccccctcagaaccccaactctggcctctttcaagggcccgtccgccccgttggacagattttggggggagaggaggtcaccaggaactcgcccacccccccttattagggaaagaggggcgaggtagcacagtgctgtacacggaaccagaatggcccccggggtggggggaggggggcaggggagggacgggggcttttagtttgcatcttaggtgggaggggggaggggggacccgccgcagttaacctgactttacgcagcgatttttaacgaggctggggggaggggggcactggggtggggacagggtggggtggggggcctggctctgttatttaccgtgtatcatatgtaaatatcgacagaaacttcaataaactttatttcaaacacgtctccgcctgcccggagggaagggattggatagagggggcttagtctgggtctctgcttctagggttgcaggcctaaagtactgcagaatgacgttagatgggtcgttgttaaatgacttaatcatcatcattatcaacggcagcgctttatacttcagtccgtgtaaagcatgcaggaccgtaaatgatactggtcaggatcaataaacgctttctcctggtattattatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]