GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-29 12:23:43, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001406810            1207 bp    mRNA    linear   PRI 01-MAY-2025
DEFINITION  Homo sapiens ephrin A4 (EFNA4), transcript variant 4, mRNA.
ACCESSION   NM_001406810
VERSION     NM_001406810.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1207)
  AUTHORS   Yuan,W., Zhao,H., Zhou,A. and Wang,S.
  TITLE     Interference of EFNA4 suppresses cell proliferation, invasion and
            angiogenesis in hepatocellular carcinoma by downregulating PYGO2
  JOURNAL   Cancer Biol Ther 23 (1), 1-12 (2022)
   PUBMED   36404439
  REMARK    GeneRIF: Interference of EFNA4 suppresses cell proliferation,
            invasion and angiogenesis in hepatocellular carcinoma by
            downregulating PYGO2.
REFERENCE   2  (bases 1 to 1207)
  AUTHORS   Kousathanas,A., Pairo-Castineira,E., Rawlik,K., Stuckey,A.,
            Odhams,C.A., Walker,S., Russell,C.D., Malinauskas,T., Wu,Y.,
            Millar,J., Shen,X., Elliott,K.S., Griffiths,F., Oosthuyzen,W.,
            Morrice,K., Keating,S., Wang,B., Rhodes,D., Klaric,L., Zechner,M.,
            Parkinson,N., Siddiq,A., Goddard,P., Donovan,S., Maslove,D.,
            Nichol,A., Semple,M.G., Zainy,T., Maleady-Crowe,F., Todd,L.,
            Salehi,S., Knight,J., Elgar,G., Chan,G., Arumugam,P., Patch,C.,
            Rendon,A., Bentley,D., Kingsley,C., Kosmicki,J.A., Horowitz,J.E.,
            Baras,A., Abecasis,G.R., Ferreira,M.A.R., Justice,A., Mirshahi,T.,
            Oetjens,M., Rader,D.J., Ritchie,M.D., Verma,A., Fowler,T.A.,
            Shankar-Hari,M., Summers,C., Hinds,C., Horby,P., Ling,L.,
            McAuley,D., Montgomery,H., Openshaw,P.J.M., Elliott,P., Walsh,T.,
            Tenesa,A., Fawkes,A., Murphy,L., Rowan,K., Ponting,C.P., Vitart,V.,
            Wilson,J.F., Yang,J., Bretherick,A.D., Scott,R.H., Hendry,S.C.,
            Moutsianas,L., Law,A., Caulfield,M.J. and Baillie,J.K.
  CONSRTM   GenOMICC investigators; 23andMe investigators; COVID-19 Human
            Genetics Initiative
  TITLE     Whole-genome sequencing reveals host factors underlying critical
            COVID-19
  JOURNAL   Nature 607 (7917), 97-103 (2022)
   PUBMED   35255492
REFERENCE   3  (bases 1 to 1207)
  AUTHORS   Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R.,
            Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S.,
            Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A.,
            Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R.,
            Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P.,
            Harper,J.W. and Gygi,S.P.
  TITLE     Dual proteome-scale networks reveal cell-specific remodeling of the
            human interactome
  JOURNAL   Cell 184 (11), 3022-3040 (2021)
   PUBMED   33961781
REFERENCE   4  (bases 1 to 1207)
  AUTHORS   Chen,Y.L., Yen,Y.C., Jang,C.W., Wang,S.H., Huang,H.T., Chen,C.H.,
            Hsiao,J.R., Chang,J.Y. and Chen,Y.W.
  TITLE     Ephrin A4-ephrin receptor A10 signaling promotes cell migration and
            spheroid formation by upregulating NANOG expression in oral
            squamous cell carcinoma cells
  JOURNAL   Sci Rep 11 (1), 644 (2021)
   PUBMED   33436772
  REMARK    GeneRIF: Ephrin A4-ephrin receptor A10 signaling promotes cell
            migration and spheroid formation by upregulating NANOG expression
            in oral squamous cell carcinoma cells.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1207)
  AUTHORS   Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W.,
            Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B.,
            Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A.,
            Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A.,
            Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C.,
            Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M.,
            Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G.,
            Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S.,
            Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A.,
            Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S.,
            Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N.,
            Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A.,
            Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M.,
            Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J.,
            Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P.,
            Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J.,
            Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   6  (bases 1 to 1207)
  AUTHORS   Zhou,R.
  TITLE     The Eph family receptors and ligands
  JOURNAL   Pharmacol Ther 77 (3), 151-181 (1998)
   PUBMED   9576626
  REMARK    Review article
REFERENCE   7  (bases 1 to 1207)
  AUTHORS   Flanagan,J.G. and Vanderhaeghen,P.
  TITLE     The ephrins and Eph receptors in neural development
  JOURNAL   Annu Rev Neurosci 21, 309-345 (1998)
   PUBMED   9530499
  REMARK    Review article
REFERENCE   8  (bases 1 to 1207)
  AUTHORS   Gale,N.W., Holland,S.J., Valenzuela,D.M., Flenniken,A., Pan,L.,
            Ryan,T.E., Henkemeyer,M., Strebhardt,K., Hirai,H., Wilkinson,D.G.,
            Pawson,T., Davis,S. and Yancopoulos,G.D.
  TITLE     Eph receptors and ligands comprise two major specificity subclasses
            and are reciprocally compartmentalized during embryogenesis
  JOURNAL   Neuron 17 (1), 9-19 (1996)
   PUBMED   8755474
REFERENCE   9  (bases 1 to 1207)
  AUTHORS   Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G.,
            Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N.,
            Shapiro,D.N. and Morris,S.W.
  TITLE     The genes encoding the eph-related receptor tyrosine kinase ligands
            LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4,
            Epl4) are clustered on human chromosome 1 and mouse chromosome 3
  JOURNAL   Genomics 33 (2), 277-282 (1996)
   PUBMED   8660976
REFERENCE   10 (bases 1 to 1207)
  AUTHORS   Kozlosky,C.J., Maraskovsky,E., McGrew,J.T., VandenBos,T., Teepe,M.,
            Lyman,S.D., Srinivasan,S., Fletcher,F.A., Gayle,R.B. 3rd,
            Cerretti,D.P. et al.
  TITLE     Ligands for the receptor tyrosine kinases hek and elk: isolation of
            cDNAs encoding a family of proteins
  JOURNAL   Oncogene 10 (2), 299-306 (1995)
   PUBMED   7838529
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL691442.32.
            
            Summary: This gene encodes a member of the ephrin (EPH) family. The
            ephrins and EPH-related receptors comprise the largest subfamily of
            receptor protein-tyrosine kinases and have been implicated in
            mediating developmental events, especially in the nervous system
            and in erythropoiesis. Based on their structures and sequence
            relationships, ephrins are divided into the ephrin-A (EFNA) class,
            which are anchored to the membrane by a
            glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB)
            class, which are transmembrane proteins. This gene encodes an EFNA
            class ephrin that has been implicated in proliferation and
            metastasis of several types of cancers. [provided by RefSeq, May
            2022].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR14372080.3010822.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2142680, SAMEA2145240
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            coronavirus related :: locus in the vicinity of disease-associated
                                   variant(s)
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-197               AL691442.32        12012-12208
            198-316             AL691442.32        12714-12832
            317-603             AL691442.32        15002-15288
            604-672             AL691442.32        15644-15712
            673-1207            AL691442.32        17291-17825
FEATURES             Location/Qualifiers
     source          1..1207
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q21.3"
     gene            1..1207
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="ephrin A4"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
     exon            1..197
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     exon            198..316
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    252..254
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="upstream in-frame stop codon"
     exon            317..603
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     CDS             432..827
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="isoform d is encoded by transcript variant 4;
                     ligand of eph-related kinase 4; eph-related receptor
                     tyrosine kinase ligand 4"
                     /codon_start=1
                     /product="ephrin-A4 isoform d"
                     /protein_id="NP_001393739.1"
                     /db_xref="GeneID:1945"
                     /db_xref="HGNC:HGNC:3224"
                     /db_xref="MIM:601380"
                     /translation="
MVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERRARVLPRSPGGGGIPAACTGGANSDRQDGALMGEIRGSEVTLAGACPLITG"
     misc_feature    <432..659
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:473140"
     exon            604..672
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     exon            673..1207
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1174..1179
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="hexamer: AATAAA"
     polyA_site      1207
                     /gene="EFNA4"
                     /gene_synonym="EFL4; EPLG4; LERK-4; LERK4"
                     /note="major polyA site"
ORIGIN      
ccctcttcactttgtacctttctctcctcgactgtgaagcgggccgggacctgccaggccagaccaaaccggacctcgggggcgatgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctgcgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccagtgtcagccctgcccttctagccgaatcacctctgggcaagtctcgtgaccttcctaacctcatttatctcacctgtataatgggctaataatacctagtaccctgggaagtctggcagggttgcttcgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccactacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactggccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctccctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctcggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagttctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggagagccagagtcctcccaagatcccctggaggaggagggatccctgctgcctgcactgggggtgccaattcagaccgacaagatggagcattgatgggggagatcagagggtctgaggtgactcttgcaggagcctgtcccctcatcacaggctaaagaagagcagtagacagccctggacactctgaagcagaggcaagacaaacacaggcgctttgcaggctgctctgagggtctcagcccatcccccaggaggactgggatttggtatgatcaaatcctcaagccagctgggggcccaggctgaagacctggggacaggtcgattgctggaccagggcaaagaagaagccctgccatctgtgccctgtgggccttttccctggggcagcaccttgccctccccaggggatcactcacttgtcttctatgaagacggactcttcatgaggttgaatttcatgccagtttgtatttttataagtatctagaccaaaccttcaataaaccactcatctttttgttgccctccccaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]