2024-04-19 07:44:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001285986 2290 bp mRNA linear PRI 25-DEC-2023 DEFINITION Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 4, mRNA. ACCESSION NM_001285986 VERSION NM_001285986.2 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2290) AUTHORS Hong L, Hong S and Zhang X. TITLE Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer JOURNAL Medicine (Baltimore) 102 (48), e36433 (2023) PUBMED 38050242 REMARK GeneRIF: Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer. REFERENCE 2 (bases 1 to 2290) AUTHORS Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K. TITLE A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer JOURNAL J Med Virol 95 (12), e29264 (2023) PUBMED 38054553 REMARK GeneRIF: A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer. REFERENCE 3 (bases 1 to 2290) AUTHORS Wang X and Dai J. TITLE Concise review: isoforms of OCT4 contribute to the confusing diversity in stem cell biology JOURNAL Stem Cells 28 (5), 885-893 (2010) PUBMED 20333750 REMARK GeneRIF: This review article underscores the importance of identifying and discriminating the expression and functions of OCT4 isoforms in stem cell research. Review article REFERENCE 4 (bases 1 to 2290) AUTHORS Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J. TITLE Mapping of the minimal internal ribosome entry site element in the human embryonic stem cell gene OCT4B mRNA JOURNAL Biochem Biophys Res Commun 394 (3), 750-754 (2010) PUBMED 20230781 REMARK GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to promote internal initiation of translation of OCT4B mRNA in embryonic stem cells was mapped. REFERENCE 5 (bases 1 to 2290) AUTHORS Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao Y, Li L, Zhao H, Zhao W, Lin H and Dai J. TITLE Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response JOURNAL Stem Cells 27 (6), 1265-1275 (2009) PUBMED 19489092 REMARK GeneRIF: OCT4 gene, by the regulation of alternative splicing and alternative translation initiation, may carry out more crucial roles in many biological events. GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG) translation initiation codon. REFERENCE 6 (bases 1 to 2290) AUTHORS Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW. TITLE OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells JOURNAL Stem Cells 26 (12), 3068-3074 (2008) PUBMED 18787205 REMARK GeneRIF: OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells REFERENCE 7 (bases 1 to 2290) AUTHORS Lee J, Kim HK, Rho JY, Han YM and Kim J. TITLE The human OCT-4 isoforms differ in their ability to confer self-renewal JOURNAL J Biol Chem 281 (44), 33554-33565 (2006) PUBMED 16951404 REMARK GeneRIF: DNA binding, transactivation, and abilities to confer self-renewal of the human OCT-4 isoforms differ REFERENCE 8 (bases 1 to 2290) AUTHORS Wey E, Lyons GE and Schafer BW. TITLE A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues JOURNAL Eur J Biochem 220 (3), 753-762 (1994) PUBMED 7908264 REFERENCE 9 (bases 1 to 2290) AUTHORS Takeda J, Seino S and Bell GI. TITLE Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues JOURNAL Nucleic Acids Res 20 (17), 4613-4620 (1992) PUBMED 1408763 REFERENCE 10 (bases 1 to 2290) AUTHORS Schoorlemmer J and Kruijer W. TITLE Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells JOURNAL Mech Dev 36 (1-2), 75-86 (1991) PUBMED 1723621 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DQ486514.1, DQ486515.1 and AI811039.1. On Aug 14, 2020 this sequence version replaced NM_001285986.1. Summary: This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]. Transcript Variant: This variant (4, also known as OCT4B1) contains multiple differences in the 5' UTR and the 5' coding region, compared to variant 1, and initiates translation at a downstream in-frame AUG start codon. The resulting isoform (4, also known as OCT4B-164) is shorter at the N-terminus, compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: KF880692.1, DR158398.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1966682, SAMEA1968189 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-507 DQ486514.1 1-507 508-508 DQ486515.1 176-176 509-1692 DQ486514.1 508-1691 1693-2276 DQ486515.1 1136-1719 2277-2290 AI811039.1 11-24 c FEATURES Location/Qualifiers source 1..2290 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6p21.33" gene 1..2290 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="POU class 5 homeobox 1" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" exon 1..1600 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756575303" variation 3..8 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aaaaa" /replace="aaaaaa" /db_xref="dbSNP:1777333579" variation 3 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777333859" variation 5 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151108087" variation 15 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:556183524" variation 19 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777333028" variation 20..21 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777332518" variation 20 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230878174" variation 22 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1343020362" variation 25 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:945378480" variation 33 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:915242328" variation 35 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1473749165" variation 38 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767061672" variation 39 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244144141" variation 41 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777330580" variation 42 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:932840583" variation 48 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777330048" variation 55 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777329779" variation 56 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1323733874" variation 59..88 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="caaatagcacttctgtcatgctggatgtca" /replace="caaatagcacttctgtcatgctggatgtcaaatagcacttctgtcatg ctggatgtca" /db_xref="dbSNP:1777326521" variation 59 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777329221" variation 60 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:3130931" variation 61 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107929" variation 67 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1223033686" variation 68 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1054562013" variation 70 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1371054306" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777328204" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggatgaagaacaag" /db_xref="dbSNP:1309830792" variation 74..75 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="atgaagaacaagtgccga" /replace="gccga" /db_xref="dbSNP:1409890798" variation 74 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777327959" variation 76 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:935889637" variation 77 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1308827226" variation 79 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777326787" variation 90 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777326233" variation 91 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:750002991" variation 94 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777325711" variation 95 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777325278" variation 101 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:979949563" variation 102 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1364491233" variation 103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777324518" variation 106 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:573550776" variation 107 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151107769" variation 114 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1300756432" variation 115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:76465289" variation 120 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777323508" variation 125 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1356944417" variation 126 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777322994" variation 127 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322739" variation 130 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322487" variation 132 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1229902923" variation 135 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:536581051" variation 136 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:983180480" variation 137 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1454069209" variation 139..141 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777320959" variation 142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1484264122" variation 144 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320435" variation 147 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320187" variation 151 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:769146675" variation 154 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:977786363" variation 156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1371506489" variation 162 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:566021008" variation 163 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777318676" variation 167 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1582037748" variation 171 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410508850" variation 172 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777317928" variation 176 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1173026294" variation 179 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749630858" variation 189 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777317122" variation 190 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:2151107559" variation 191 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1166012936" variation 192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:950476755" variation 193 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316548" variation 199 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107531" variation 201 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1184040360" variation 203 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316008" variation 206 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776087600" variation 221 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200340326" variation 222..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="atga" /replace="atgatga" /db_xref="dbSNP:67207605" variation 222 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1185683743" variation 223..224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="aag" /replace="tag" /db_xref="dbSNP:1777314586" variation 223 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:77085553" variation 224..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gag" /replace="gaggag" /db_xref="dbSNP:9281235" variation 224..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ga" /replace="gaaga" /replace="gacga" /db_xref="dbSNP:1777313779" variation 224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggag" /replace="gtgg" /db_xref="dbSNP:72545985" variation 225..228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="agta" /replace="agtagta" /db_xref="dbSNP:2151107394" variation 225..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agaag" /db_xref="dbSNP:141270342" variation 226..227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gat" /db_xref="dbSNP:1777312621" variation 226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gagg" /db_xref="dbSNP:1554135573" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="t" /db_xref="dbSNP:1372634738" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:201576321" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777312105" variation 228..229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gt" /db_xref="dbSNP:1561858807" variation 228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1432689419" variation 229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:553951373" variation 231 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1340775926" variation 233 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777310661" variation 234 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1483419984" variation 237 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777310112" variation 240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1450163111" variation 248 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1268187140" variation 249 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1208146203" variation 250 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:917183324" variation 256 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777308694" variation 258 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777308361" variation 260 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:991404678" variation 264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1238039827" variation 271 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:958551486" variation 274 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1314969939" variation 278 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1443317976" variation 279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1290134588" variation 280..284 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tgt" /replace="tgtgt" /db_xref="dbSNP:571828146" variation 280 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1240827545" variation 281 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:920402080" variation 283 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107235" variation 286 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151107222" variation 287 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:995080389" variation 289 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304963" variation 294 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:961733064" variation 295 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1014676128" variation 297 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107175" variation 299 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304114" variation 300..301 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="cc" /replace="ccc" /db_xref="dbSNP:1777303834" variation 302 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107154" variation 308 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1172171053" variation 313 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777303249" variation 314 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1402669669" variation 319 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777302766" variation 320 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1280756512" variation 321 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1388044631" variation 323 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:72856737" variation 328 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:868073649" variation 329 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151107091" variation 331 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:571668450" variation 333 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:759635638" variation 338 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107071" variation 340 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1368067216" variation 346 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1232121017" variation 348 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:545437201" variation 349 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:9263800" variation 355 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777299299" variation 356 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777299064" variation 357 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:11965454" variation 358 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777298772" variation 364 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107008" variation 365 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106995" variation 366 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1282835556" variation 367..369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aca" /db_xref="dbSNP:1429225310" variation 367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1464849350" variation 369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1473170859" variation 370 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777297246" variation 371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:893827576" variation 374 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250012422" variation 375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1467154259" variation 376 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777296078" variation 377 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777295791" variation 380..381 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cc" /db_xref="dbSNP:1198482935" variation 380 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777295522" variation 382..386 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tttt" /replace="ttttt" /db_xref="dbSNP:1378392227" variation 384 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777294937" variation 387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294345" variation 388 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294068" variation 394 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1478925844" variation 396 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777293504" variation 397 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1156581301" variation 400 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410882052" variation 404 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151106839" variation 407 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:567697919" variation 409 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1322418862" variation 416 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:3757349" variation 434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903306193" variation 440 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777291168" variation 443 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777290863" variation 448 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106776" variation 450 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:775390135" variation 451 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323876773" variation 453 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777289999" variation 455 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:905789598" variation 458..460 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gag" /db_xref="dbSNP:1777289394" variation 460..462 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gtg" /replace="gtgtg" /db_xref="dbSNP:1777289142" variation 466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:73401031" variation 468 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777288544" variation 477 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106706" variation 483 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151106697" variation 488 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106686" variation 489 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777288254" variation 494..499 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttcttt" /db_xref="dbSNP:550996676" variation 495..497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tct" /db_xref="dbSNP:1554135441" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1554135451" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777287697" variation 497..508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ttttttttt" /replace="tttttttttt" /replace="ttttttttttt" /replace="tttttttttttt" /replace="ttttttttttttt" /db_xref="dbSNP:rs9279005" variation 497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1204843522" variation 502 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:949924521" variation 504 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1463720016" variation 507 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1269728421" variation 508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:201876558" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777284056" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:200941459" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /db_xref="dbSNP:1322683938" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1209148552" variation 518..521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agag" /db_xref="dbSNP:776463063" variation 518 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1777282729" variation 521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1254214943" variation 526 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250844879" variation 527..530 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctct" /db_xref="dbSNP:1234752211" variation 529 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777281473" variation 531 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1161350339" variation 534 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777280491" variation 535 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777280177" variation 538 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:950118066" variation 540 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1457019029" variation 546 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:574609806" variation 547 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1582036271" variation 555 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1380101000" variation 556 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:983642581" variation 570 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1306970706" variation 575 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1582036200" variation 576 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777277431" variation 580 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1322911050" variation 581 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:929059992" variation 585 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777276499" variation 586 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777276066" variation 587 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:141017974" variation 588 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1300309753" variation 592 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777274980" variation 595 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777274684" variation 599 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1561857968" variation 604 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1582036092" variation 605 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777273790" variation 608 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:973063617" variation 609 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1582036067" variation 610 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:964318755" variation 611 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777272508" variation 625 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:151095308" variation 626 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777271795" variation 628 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582036011" variation 635 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777271173" variation 638 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777270899" variation 641 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1203311467" variation 642 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1483285873" variation 644 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777269970" variation 646 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1245688817" variation 649 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:961842977" variation 650 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1423175744" variation 651 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777268707" variation 654 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:907643738" variation 655 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777268123" variation 659 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:533115866" variation 661 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:954544116" variation 662..666 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tttt" /replace="ttttt" /db_xref="dbSNP:1561857858" variation 669 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1371755091" variation 674 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1167617089" variation 675 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777266300" variation 678 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1370782162" variation 683 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:779561772" variation 684 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777265399" variation 686 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:955078906" variation 687 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777264737" variation 692 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1377345590" variation 695 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1192583085" variation 697 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1314005077" variation 701 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1021109193" variation 706 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777263170" variation 718 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1028628180" variation 722 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777261934" variation 725 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1010088871" variation 726 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777261360" variation 728 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1297231507" variation 729 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:893908328" variation 732 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1207472601" variation 733 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1032397103" variation 734 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151105975" variation 736 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1460740055" variation 737 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1002211292" variation 744 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:562465318" variation 745 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1561857678" variation 755 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151105898" variation 757 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777258652" variation 759 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:770180344" variation 762 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:964250913" variation 763 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1242653526" variation 766 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1183137274" variation 768 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1440123342" variation 772 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1249038204" variation 773 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:3132526" variation 774 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1561857616" variation 779 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:573636729" variation 780 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777255462" variation 782 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1291997215" variation 783 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1247763647" variation 784 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:756964786" variation 785 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:949991822" variation 786 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1442835906" variation 789 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1337392829" variation 793 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777253665" variation 794 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777253402" variation 795 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777253136" variation 797 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151105737" variation 800 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1357816400" variation 801 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1326790090" variation 802..816 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="taaccttcataacct" /replace="taaccttcataaccttcataacct" /db_xref="dbSNP:1777250501" variation 802 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1408941217" variation 807 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1303980168" variation 808 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1365998522" variation 810 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777251361" variation 811 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777251095" variation 815 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777250801" variation 824 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:746682206" variation 825..828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ttct" /replace="ttcttct" /db_xref="dbSNP:67257409" variation 825..826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gc" /db_xref="dbSNP:28728473" variation 825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:777344152" variation 825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tgct" /db_xref="dbSNP:1561857487" variation 826..827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="atc" /replace="gtc" /replace="ttc" /db_xref="dbSNP:2151105584" variation 826..827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tc" /replace="tcctc" /db_xref="dbSNP:1554135249" variation 826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2070701153" variation 826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:71563310" variation 827..829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ctc" /replace="ctcctc" /db_xref="dbSNP:9281234" variation 827..828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctact" /replace="ctgct" /db_xref="dbSNP:2151105499" variation 827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cacc" /replace="cc" /replace="cccc" /replace="cgcc" /db_xref="dbSNP:rs1554135251" variation 828 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777247687" variation 829..830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ctg" /replace="ctt" /db_xref="dbSNP:79966288" variation 829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="ctcc" /db_xref="dbSNP:1554135252" variation 830..831 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="tca" /replace="tcc" /db_xref="dbSNP:1159152310" variation 830 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:752409659" variation 838 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1311441900" variation 839 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:561385932" variation 844..850 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tct" /replace="tctttct" /db_xref="dbSNP:1471206311" variation 844 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:765257293" variation 847 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1252825210" variation 848 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:868416189" variation 853 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1362514380" variation 858 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777243744" variation 860 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:754865454" variation 861 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1265163" variation 863 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1271554852" variation 867 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:920359564" variation 869 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777242610" variation 871 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151105316" variation 873 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1561857278" variation 875 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:973093406" variation 879 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777241739" variation 880 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777241468" variation 882 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777241192" variation 885 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1489760262" variation 886 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1189136114" variation 888 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777240374" variation 894..898 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1423998752" variation 896 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777240102" variation 897 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1288712416" variation 903 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1433024511" variation 904 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151105201" variation 907 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777238944" variation 908 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:572416729" variation 909 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:761916552" variation 913 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:910216174" variation 915 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:115513668" variation 918 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1456136909" variation 919 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1227753208" variation 935 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1345889080" variation 941 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:58535985" variation 942 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:58132172" variation 943 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427955524" variation 945 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777235654" variation 946 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1055684992" variation 954 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1304792735" variation 958 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1437341593" variation 960 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:954964862" variation 962 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1021600248" variation 963 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1292063532" variation 963 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777233811" variation 966 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:76364340" variation 971 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1349458032" variation 976 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1303151899" variation 981 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1319251305" variation 983 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:763461206" variation 987 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1405930812" variation 991 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1159041236" variation 996 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:958411387" variation 998 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1481081875" variation 1001 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:775689149" variation 1003 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1197635439" variation 1005 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:3130932" variation 1007 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:746349953" variation 1008 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151104931" variation 1012 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1216104654" variation 1014 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:374060997" variation 1021 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:770437114" variation 1022 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1300240387" variation 1025 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777227576" variation 1026 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:751818073" variation 1028 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:777447714" variation 1029 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1285130324" variation 1030 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1221408916" variation 1032 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1366683434" variation 1037 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1270956235" variation 1038 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /db_xref="dbSNP:1343489733" variation 1038 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:748039347" variation 1041 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1320046736" variation 1045 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1470348977" variation 1048 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1192525392" variation 1054 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:9501063" variation 1055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1174939469" variation 1057 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1471798553" variation 1058 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:753723388" variation 1060 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151104758" variation 1062 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:780099361" variation 1063 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1159138802" variation 1064 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:374746302" variation 1068 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:751667986" variation 1069 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:764458539" variation 1072 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1187321294" variation 1074 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1461395860" variation 1078..1081 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ctgg" /db_xref="dbSNP:1162777202" variation 1078 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:72856736" variation 1080 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1207984449" variation 1081 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1561856622" variation 1085 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582033638" variation 1086 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1014613031" variation 1088 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:765521397" variation 1090 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777217414" variation 1091 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:759883550" variation 1094 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:777021724" variation 1095..1096 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="tt" /db_xref="dbSNP:1453409159" variation 1096 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:760230615" variation 1098 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1582033488" variation 1099 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:772698923" variation 1103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:771780451" variation 1106 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:747761780" variation 1108 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1355465893" variation 1115..1118 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aaa" /replace="aaaa" /db_xref="dbSNP:1175259104" variation 1115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777213682" variation 1121 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:778571821" variation 1125 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:768359010" variation 1128 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1489249310" variation 1129 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1387884870" variation 1132 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1167606498" variation 1135 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:749071230" variation 1136 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408966195" variation 1137 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1288972831" variation 1139 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244494688" variation 1140 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:149025884" variation 1142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1226467340" variation 1143 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:137936040" variation 1148 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777208385" variation 1156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:751745427" variation 1157 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:777993058" variation 1159 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1321757885" variation 1162 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:150320288" variation 1165 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1274145021" variation 1166 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151104326" variation 1174 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1561856346" variation 1180 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777205659" variation 1185 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777205330" variation 1192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1247046824" variation 1195 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1361655165" variation 1196 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1272018324" variation 1204 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777203896" variation 1210 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1313084641" variation 1213 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1395953191" variation 1214 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1374605227" variation 1222 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:752871883" variation 1225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1440419653" variation 1227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:910240285" variation 1236 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1307000564" variation 1240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582032778" variation 1241 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777200309" variation 1253 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:765446871" variation 1255 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:368865757" variation 1260 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:372561846" variation 1264..1265 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /replace="ttt" /db_xref="dbSNP:200370996" variation 1265 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151104120" variation 1268 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1408568290" variation 1271 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:45506394" variation 1272 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:773644692" variation 1274 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1405994057" variation 1277 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1250867103" variation 1278..1281 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="cccc" /replace="ccccc" /db_xref="dbSNP:767101644" variation 1279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:771496772" variation 1281 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:761338834" variation 1283 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777195943" variation 1285 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:45438402" variation 1288 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1368930453" variation 1293 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1317624374" variation 1294 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1309748062" variation 1295 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1227144047" variation 1301 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:988757143" variation 1305 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:534141870" variation 1311..1324 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aggggcaggggcag" /replace="aggggcaggggcaggggcag" /db_xref="dbSNP:2151103949" variation 1314 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:566787524" variation 1317 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="a" /db_xref="dbSNP:1445779121" variation 1317 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:761782197" variation 1323 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:776548442" variation 1325..1326 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="at" /db_xref="dbSNP:2151103942" variation 1326..1327 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ct" /db_xref="dbSNP:1554134967" variation 1326..1327 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ct" /db_xref="dbSNP:2151103916" variation 1326..1327 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctct" /db_xref="dbSNP:3064871" variation 1326 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cgc" /db_xref="dbSNP:2151103935" variation 1327..1328 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="cta" /db_xref="dbSNP:1554134963" variation 1327..1328 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ta" /replace="tata" /db_xref="dbSNP:2151103891" variation 1327 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:764010389" variation 1329 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1268361667" variation 1331 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:967965078" variation 1336 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777190285" variation 1338 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777190004" variation 1340 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777189706" variation 1342 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777189403" variation 1344 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="a" /db_xref="dbSNP:1229527301" variation 1348 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151103815" misc_feature 1349..1351 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="upstream in-frame stop codon" variation 1349 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777188783" variation 1354..1356 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aga" /replace="agaaga" /db_xref="dbSNP:1777188486" variation 1360 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:925432227" variation 1366..1367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="acttgg" /replace="tcttgg" /db_xref="dbSNP:1777187532" variation 1366 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:878955940" variation 1367..1372 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gctttg" /replace="gctttggctttg" /db_xref="dbSNP:2151103678" variation 1367..1370 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gctt" /replace="gcttggctt" /replace="gcttgggctt" /db_xref="dbSNP:74525213" variation 1367..1369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gct" /replace="gctcgggct" /db_xref="dbSNP:2151103744" variation 1367..1368 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gc" /replace="gcatgggc" /replace="gcctgggc" /replace="gcgtgggc" /db_xref="dbSNP:2151103752" variation 1367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gattggg" /replace="ggcttggg" /replace="ggg" /replace="ggttggg" /replace="gtttggg" /db_xref="dbSNP:rs200714691" variation 1367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1251837933" variation 1369..1371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /replace="tttt" /db_xref="dbSNP:367730301" variation 1369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tgggctt" /db_xref="dbSNP:143097483" variation 1370..1371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /replace="gggctc" /db_xref="dbSNP:879167087" variation 1370 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tgggct" /db_xref="dbSNP:1777186228" variation 1371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:755546995" variation 1372 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gcttggg" /db_xref="dbSNP:149056926" variation 1374 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151103661" variation 1375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1449478933" variation 1377 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777183904" variation 1384 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:551624054" variation 1387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:533052915" variation 1395 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151103626" variation 1397 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777182985" variation 1404 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1439879356" variation 1405 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:895943169" variation 1406 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1034391209" variation 1410 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1357559949" variation 1418 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777181447" variation 1419 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1350236456" variation 1420 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:768323673" variation 1424 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151103567" variation 1427 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:187046732" variation 1428 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:756724092" variation 1431 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1291455915" variation 1434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:769916722" variation 1435 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:745803283" variation 1438 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1161176813" variation 1439 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2106074" variation 1444 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1410948036" variation 1447 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1199796735" variation 1448..1453 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tctttt" /db_xref="dbSNP:761437827" variation 1449 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:200784165" variation 1456 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1209509392" variation 1457 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:748214914" variation 1459 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151103464" variation 1460 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:779057746" variation 1463 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1163570062" variation 1464 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:367652843" variation 1465 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1328995353" variation 1466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777175095" variation 1467 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1284497097" variation 1471 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754269967" variation 1475 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1329745808" variation 1477 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951425605" variation 1482 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298706028" variation 1489 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:373808092" variation 1492 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777172331" variation 1495 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1362025857" variation 1498 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1290187689" variation 1500 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777171228" variation 1516 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1455194086" variation 1520 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777170549" variation 1525 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1387743881" variation 1527 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756413624" CDS 1532..2026 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="isoform 4 is encoded by transcript variant 4; POU-type homeodomain-containing DNA-binding protein; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; octamer-binding protein 3; octamer-binding protein 4; octamer-binding transcription factor 3" /codon_start=1 /product="POU domain, class 5, transcription factor 1 isoform 4" /protein_id="NP_001272915.1" /db_xref="CCDS:CCDS75420.1" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" /translation="
MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"
misc_feature <1532..1579 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:419906" misc_feature order(1634..1648,1652..1654,1703..1705,1721..1723, 1760..1762,1766..1771,1778..1783,1787..1795,1799..1804) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1640..1804 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(1640..1642,1649..1651,1769..1771,1778..1783, 1790..1792) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" variation 1540 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777169354" variation 1543 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:115234511" variation 1544 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:768029325" variation 1545 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1037478772" variation 1549 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429404142" variation 1557 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151103219" variation 1570 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1341968669" variation 1575 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777167062" variation 1580 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1007322893" variation 1585 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777166338" variation 1589 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:572480837" variation 1590 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777165573" variation 1596 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1186685294" variation 1598 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:773889469" variation 1600 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:763710527" exon 1601..1759 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1602 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777140852" variation 1603 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777140477" variation 1604 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1441261772" variation 1605 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1256075529" variation 1608 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1196692240" variation 1612 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1016182724" variation 1619 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1150767" variation 1621 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:780201728" variation 1622 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:750755680" variation 1627 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767958442" variation 1628 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1340827343" variation 1631 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1315221039" variation 1632 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246353090" variation 1635 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777135286" variation 1636 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1338565059" variation 1641 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1333452170" variation 1643 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777134129" variation 1648 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1391716274" variation 1649 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777133457" variation 1651 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151102295" variation 1654 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:757769384" variation 1659 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1306384765" variation 1661 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429420206" variation 1662 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:751096375" variation 1663 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:368434272" variation 1665 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1471859282" variation 1666 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368353231" variation 1668 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777130443" variation 1669 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1183206781" variation 1670 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1052108705" variation 1672 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:578180451" variation 1687 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:775301501" variation 1691 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1325738578" variation 1702 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:764939136" variation 1708 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:17851818" variation 1711 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951452940" variation 1712 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777126425" variation 1714 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776478147" variation 1722 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1353681075" variation 1725 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:770844532" variation 1730 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777125291" variation 1732 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:746974556" variation 1741 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1352084514" variation 1745 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1286303728" variation 1746 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408995142" variation 1747 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427351164" variation 1750 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:772966815" variation 1751 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:768746587" variation 1754 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749326531" variation 1755 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777122104" variation 1757 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1390168415" exon 1760..2290 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1760 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1188579160" variation 1761 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:770067555" variation 1762 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246075526" variation 1765 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777088374" variation 1766 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1208076129" variation 1767 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:746104715" variation 1768 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1384083039" variation 1770 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1280550252" variation 1771 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298955101" variation 1773 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:867664390" variation 1777 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:781212227" variation 1785 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1271010739" variation 1786 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1437313632" variation 1787 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777084166" variation 1789 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777083772" variation 1796 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777083413" variation 1797 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1363163301" variation 1802 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777082620" variation 1811 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:771345851" variation 1813 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:141766253" variation 1814 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778460021" variation 1818 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777081085" variation 1819 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1174320263" variation 1821 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:546320542" variation 1822..1826 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ac" /replace="acaac" /db_xref="dbSNP:765569430" variation 1824 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777079901" variation 1825 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1423969939" variation 1827 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:950764201" variation 1829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1486650077" variation 1838 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:758948344" variation 1849 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777077666" variation 1851 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:752325450" variation 1853 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1189046873" variation 1862 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778574549" variation 1864 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1314271734" variation 1866 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1030266660" variation 1871 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1483497814" variation 1875 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974056564" variation 1876 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1480295008" variation 1879 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777074060" variation 1883 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1200837847" variation 1884 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:16897482" variation 1886 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777072975" variation 1887 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1207698528" variation 1888 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1432082123" variation 1889 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1441659931" variation 1894 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754481951" variation 1898 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230947193" variation 1903 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777070734" variation 1909 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:753553081" variation 1916 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:765910375" variation 1922 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777069475" variation 1924 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1246815764" variation 1927 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1158543431" variation 1930 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1374581600" variation 1936 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:997814201" variation 1939 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1301635040" variation 1942 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777067093" variation 1944 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:760558360" variation 1947 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1355522268" variation 1950 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:750163518" variation 1951 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767500519" variation 1952 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1387940273" variation 1955 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1016136973" variation 1962 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1038848905" variation 1963 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:761734933" variation 1967 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:986006262" variation 1969 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777063161" variation 1973 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1348560317" variation 1975 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:953270489" variation 1976 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1284370986" variation 1977 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1318153696" variation 1981 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:774206292" variation 1982..1984 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="cct" /db_xref="dbSNP:1777060496" variation 1982 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:769875118" variation 1985 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777060142" variation 1990 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061118" variation 1991 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1207558407" variation 1995 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061120" variation 1998 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:776940833" variation 2001 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1274211726" variation 2003 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1222340156" variation 2004 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777056973" variation 2005 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:771024256" variation 2007 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1223697753" variation 2013 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:747446765" variation 2021 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1191115401" variation 2027 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427929496" variation 2028 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:997296748" variation 2031 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:892230384" variation 2036 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1554134152" variation 2037 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:564148752" variation 2043 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1434585421" variation 2045..2046 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1408399482" variation 2046 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777052599" variation 2048..2052 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1351162048" variation 2048 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368265136" variation 2050 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1307060444" variation 2052 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1457938687" variation 2054 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1162581262" variation 2055..2056 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ag" /db_xref="dbSNP:1491028222" variation 2055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="a" /db_xref="dbSNP:1163021077" variation 2055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1554134128" variation 2055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:772503540" variation 2057 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:748680648" variation 2063 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777048797" variation 2065 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777048444" variation 2066 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903483977" variation 2067 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:779517517" variation 2070 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754549702" variation 2074 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1251306973" variation 2080 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777046704" variation 2082 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1061126" variation 2087 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777045960" variation 2092..2094 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:1777045583" variation 2095 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777045236" variation 2097 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1777044891" variation 2098 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1304742773" variation 2099 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151100101" variation 2101 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:3734864" variation 2102 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1409164251" variation 2103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1189358100" variation 2104 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777042927" variation 2129 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1472556225" variation 2131 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1249631450" variation 2141 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1226100360" variation 2145 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777041453" variation 2151..2153 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aaa" /replace="aaaaa" /db_xref="dbSNP:60004964" variation 2151 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777041138" variation 2152 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200275741" variation 2156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:917547918" variation 2160 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:896681857" variation 2171..2173 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:746543478" variation 2174..2177 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1777038521" variation 2175 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:938900222" variation 2177 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1482261391" variation 2178 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1057051690" variation 2180 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777037472" variation 2185 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1233955454" variation 2196 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777036766" variation 2207 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777036406" variation 2218 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:930130200" variation 2228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:537327593" variation 2229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1481698220" variation 2230 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1265122857" variation 2231 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777034633" variation 2234 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:927467930" variation 2237 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:980276667" variation 2238 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151099846" variation 2242 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777033427" variation 2243 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1388129250" variation 2245 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777032759" variation 2251..2258 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="taaa" /replace="taaataaa" /db_xref="dbSNP:1409128704" variation 2252..2254 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777032031" variation 2252 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323343063" regulatory 2253..2258 /regulatory_class="polyA_signal_sequence" /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="hexamer: AATAAA" variation 2256..2261 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaagaa" /db_xref="dbSNP:1777031252" variation 2262..2264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gcc" /db_xref="dbSNP:750617181" variation 2263 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1313339858" variation 2264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:13409" variation 2273 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1356217144" variation 2275 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777029217" variation 2279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777028855" variation 2280..2282 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aga" /db_xref="dbSNP:1777028490" variation 2283 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:983923886" variation 2286 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1445660115" variation 2289 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974089105" polyA_site 2290 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="major polyA site" ORIGIN
ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacaggtgcgtgccaccgtgcccagctaatttttgtgtttttagtagagacggggtttcaccatgttggccatgctggtcttgaactcctgacctcgtgatctgcccacctcggcctcccaaagtgctggaattataggcgtgagccaccgcgcccagcaaagaacttctaaccttcataacctgacaggtgttctcgaggccagggtctctctttctgtcctttcacgatgctctgcatcccttggatgtgccagtttctgggggaagagtagtcctttgttacatgcatgagtcagtgaacagggaatgggtgaatgacatttgtgggtaggttatttctagaagttaggtgggcagcttggaaggcagaggcacttctacagactattccttggggccacacgtaggttcttgaatcccgaatggaaaggggagattgataactggtgtgtttatgttcttacaagtcttctgccttttaaaatccagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttggtgggttcccctctgcagattctgaccgcatctcccctctaaggagtatccctgaacctagtggggaggggcaggggcagactaccctcacccatgaagaggagtagggagagggagaagatgctttgagctccctctgggaagaggtggtaagcttggatctcagggtcacaagggccctgcgtgctccctcactttgcttctcttttgactggcctcccccagggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacactta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]