2025-06-07 15:20:19, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_205379 1610 bp mRNA linear VRT 06-AUG-2024 DEFINITION Gallus gallus TGFB induced factor homeobox 1 (TGIF1), mRNA. ACCESSION NM_205379 VERSION NM_205379.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1610) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1610) AUTHORS Lorda-Diez,C.I., Montero,J.A., Sanchez-Fernandez,C., Garcia-Porrero,J.A., Chimal-Monroy,J. and Hurle,J.M. TITLE Four and a half domain 2 (FHL2) scaffolding protein is a marker of connective tissues of developing digits and regulates fibrogenic differentiation of limb mesodermal progenitors JOURNAL J Tissue Eng Regen Med 12 (4), e2062-e2072 (2018) PUBMED 29330921 REMARK GeneRIF: Gain-of-function and loss-of-function experiments in the micromass culture assay revealed a positive transcriptional influence of Fhl2 in the expression of TGIF1. REFERENCE 3 (bases 1 to 1610) AUTHORS Lorda-Diez,C.I., Montero,J.A., Martinez-Cue,C., Garcia-Porrero,J.A. and Hurle,J.M. TITLE Transforming growth factors beta coordinate cartilage and tendon differentiation in the developing limb mesenchyme JOURNAL J Biol Chem 284 (43), 29988-29996 (2009) PUBMED 19717568 REMARK GeneRIF: Tgif1 gene regulation by TGFbeta signaling correlated with the differential chondrogenic and fibrogenic effects of this pathway. In functional experiments, Tgif1 reproduces the profibrogenic effect of TGFbeta treatments. REFERENCE 4 (bases 1 to 1610) AUTHORS Dong,Y.F., Soung do,Y., Chang,Y., Enomoto-Iwamoto,M., Paris,M., O'Keefe,R.J., Schwarz,E.M. and Drissi,H. TITLE Transforming growth factor-beta and Wnt signals regulate chondrocyte differentiation through Twist1 in a stage-specific manner JOURNAL Mol Endocrinol 21 (11), 2805-2820 (2007) PUBMED 17684115 REMARK GeneRIF: Twist1 may be an important regulator of chondrocyte progression toward terminal maturation in response to TGF-beta and canonical Wnt signaling REFERENCE 5 (bases 1 to 1610) AUTHORS Ryan,A.K., Tejada,M.L., May,D.L., Dubaova,M. and Deeley,R.G. TITLE Isolation and characterization of the chicken homeodomain protein AKR JOURNAL Nucleic Acids Res 23 (16), 3252-3259 (1995) PUBMED 7667102 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000043.1. On Sep 23, 2021 this sequence version replaced NM_205379.1. ##Evidence-Data-START## Transcript exon combination :: HAEL01004190.1, HAEL01010388.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992323 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-301 JAENSK010000043.1 3322171-3322471 c 302-528 JAENSK010000043.1 3316390-3316616 c 529-1610 JAENSK010000043.1 3313936-3315017 c FEATURES Location/Qualifiers source 1..1610 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="2" /map="2" gene 1..1610 /gene="TGIF1" /gene_synonym="TGIF" /note="TGFB induced factor homeobox 1" /db_xref="CGNC:49758" /db_xref="GeneID:396339" exon 1..301 /gene="TGIF1" /gene_synonym="TGIF" /inference="alignment:Splign:2.1.0" misc_feature 157..159 /gene="TGIF1" /gene_synonym="TGIF" /note="upstream in-frame stop codon" CDS 286..1095 /gene="TGIF1" /gene_synonym="TGIF" /note="homeodomain protein AKR; TGFB-induced factor (TALE family homeobox); avian knotted-related protein" /codon_start=1 /product="homeobox protein AKR" /protein_id="NP_990710.2" /db_xref="CGNC:49758" /db_xref="GeneID:396339" /translation="
MKSKKGVVAISGSETEDDDTMDVPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKVLLSRQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGTKLPEGSMVESSMGTKNFLPLLEESPFLPASATLSKTVSSSKPVSPGSVLARPSVICHTTVTALKDAPFHFCQPGDVGQTTDLQQPPANAFTDSSLSYHEDASKLGPGANAQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLVA"
misc_feature 286..408 /gene="TGIF1" /gene_synonym="TGIF" /note="propagated from UniProtKB/Swiss-Prot (Q90655.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(391..405,409..411,469..471,487..489,526..528, 532..537,544..549,553..561) /gene="TGIF1" /gene_synonym="TGIF" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(397..399,406..408,535..537,544..549,556..558) /gene="TGIF1" /gene_synonym="TGIF" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 445..561 /gene="TGIF1" /gene_synonym="TGIF" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" misc_feature 922..993 /gene="TGIF1" /gene_synonym="TGIF" /note="propagated from UniProtKB/Swiss-Prot (Q90655.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 302..528 /gene="TGIF1" /gene_synonym="TGIF" /inference="alignment:Splign:2.1.0" exon 529..1610 /gene="TGIF1" /gene_synonym="TGIF" /inference="alignment:Splign:2.1.0" ORIGIN
gggtgactctgcctcagtcactgcgggaagggggagggcggccgcgcgcaccttttcctcccgtgccttctcccactttcacgaggaaggaacaaaggcgaagcgagcccgcagccgccggaaagcccccaagggaggcggaatcccgctgctccctgacagcgacgcggccccgggccggccgtctggccgcgcttcttcgccgccctcctcctcgtcgccgagttgagaaggggagcagcgtcccgcctcgcctctcggagcgcggcggtcctcgccggcacgatgaaaagtaaaaaaggtgtagttgcaatatcaggcagtgaaacagaggatgatgacactatggatgtcccactagatctttcctcatctgctggctcgggcaaacggaggagacgtggcaacctacccaaagagtccgtgcagattcttcgggactggctgtatgagcaccgatacaatgcttatccttcagagcaagaaaaagtgctgttatcccggcaaacacacctctccacactacaggtctgcaactggtttatcaacgcacgccgcaggctcttacctgatatgctgaggaaggacggcaaagacccaaaccagttcaccatctcacggcgggggaccaagcttcctgaaggcagcatggtggagtcctccatgggcacaaagaacttccttcccttgctggaggagagccccttccttcccgcctctgccacgctcagcaagactgtgtcctcttccaagcctgtgtccccagggtctgtcctggctcggccctctgtgatttgccacacgactgtgactgcgttgaaagatgcccctttccatttttgtcagccaggtgatgtaggccagaccacagacctgcagcagcccccggccaacgccttcacagacagctccctctcctaccacgaggatgcctctaaactgggacctggtgcgaatgcgcaaagcgggctctttaacactcctcctccaaccccaccagacctcaaccaggattttagtggattccagctactggtggatgttgcactcaaaagggcggcagagatggagttgcaggcaaaactcgtggcctaaatccccttccttctctttccccattttgttttttatccaggcagggatctaacagctgtgtggttattgccacccacacgatatcaaaagacttaactgcattattattattttttttttattaatcttatttgcacaagggattgctgaaatgaagcttcctgtcactgagatggtcttcagtggaatatggtcattccaagaattataaactttaaagctactgtagaaaggattgtgtggtttttgtttttgttttttttttgttttgttttttttaatattttctttgtaggtttttcataatgtgagatggttcccaagatcatgtgatttgtttttttctatcagactgtgcaatatctagtaatgatatagagtcttcttatcattcccatgcggaacagaatataccgacacgctgtctaaaataaattttcaatttttttaacaatatgaactttggatgattatgctttttttcccacaatgtaataaaatattttctttaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]