LOCUS       NM_205252               1895 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA.
ACCESSION   NM_205252
VERSION     NM_205252.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1895)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1895)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1895)
  AUTHORS   Obinata A and Akimoto Y.
  TITLE     Involvement of Hex in the initiation of feather morphogenesis
  JOURNAL   Int J Dev Biol 49 (8), 953-960 (2005)
   PUBMED   16281172
  REMARK    GeneRIF: Hex is upstream of Wnt7a and beta-catenin and regulates
            the Wnt signaling pathway in feather bud initiation
REFERENCE   4  (bases 1 to 1895)
  AUTHORS   Obinata A and Akimoto Y.
  TITLE     Expression of Hex during feather bud development
  JOURNAL   Int J Dev Biol 49 (7), 885-890 (2005)
   PUBMED   16172986
  REMARK    GeneRIF: Hex plays an important role in the initiation of feather
            morphogenesis
REFERENCE   5  (bases 1 to 1895)
  AUTHORS   Crompton MR, Bartlett TJ, MacGregor AD, Manfioletti G, Buratti E,
            Giancotti V and Goodwin GH.
  TITLE     Identification of a novel vertebrate homeobox gene expressed in
            haematopoietic cells
  JOURNAL   Nucleic Acids Res 20 (21), 5661-5667 (1992)
   PUBMED   1360645
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000232.1.
            
            On Sep 23, 2021 this sequence version replaced NM_205252.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X64711.1, AJ452462.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-478               JAENSK010000232.1  735945-736422       c
            479-657             JAENSK010000232.1  734531-734709       c
            658-708             JAENSK010000232.1  734397-734447       c
            709-1895            JAENSK010000232.1  732106-733292       c
FEATURES             Location/Qualifiers
     source          1..1895
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="6"
                     /map="6"
     gene            1..1895
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="hematopoietically expressed homeobox"
                     /db_xref="CGNC:66222"
                     /db_xref="GeneID:396182"
     exon            1..478
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     CDS             97..930
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="homeobox protein HEX; homeobox protein PRH"
                     /codon_start=1
                     /product="hematopoietically-expressed homeobox protein
                     HHEX"
                     /protein_id="NP_990583.2"
                     /db_xref="CGNC:66222"
                     /db_xref="GeneID:396182"
                     /translation="

MQYQAPGAAPAAALGVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAAPAPHSLPAPPPPTLPSPNSSFTSLVAPYRTPVYEPTPIHPAFSHHLAATYGTGAYAGPLYSFPRAVGDYTHALIRQDPLGKPLLWSPFIQRPLHKRKGGQVRFSNEQTIELEKKFETQKYLSPPERKRLAKLLQLSERQVKTWFQNRRAKWRRLKQENPQATKKEEAEGTGDHGDPRPEGSPSPAGGGEAEPQDSPSAASQEDPESDVSDDSDQEVDIEGDKGFYSATR"

     misc_feature    235..303
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="propagated from UniProtKB/Swiss-Prot (Q05502.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(529..543,547..549,598..600,616..618,655..657,
                     661..666,673..678,682..690,694..699)
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(535..537,544..546,664..666,673..678,685..687)
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    541..696
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    691..927
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="propagated from UniProtKB/Swiss-Prot (Q05502.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            479..657
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     exon            658..708
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     exon            709..1895
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggagaaacccgcggcggcggtggcagcagccggcggccgcgctcggggccgctctccgaggggcggccgggccgcggggggccggggagccgcgccatgcagtatcaggcgccgggcgcggctccggcggcggccctgggcgtcggcgtccctctgtacgcgcccacgccgctgctgcagcccgcgcaccccacgcccttctacatcgaggacatcctgggccgcggccccgccgccgcgccggccccccactccctgcccgccccgccgccgccgacgctgccgtcgcccaactcctccttcaccagcctggtggccccgtaccggacccccgtctacgagccgacccccatccacccggccttctctcaccacctcgccgccacctacggcaccggcgcttacgccgggcccctctactcctttccccgcgccgtcggcgactacacgcacgcactgatccgccaggaccccctgggaaagccgctgctgtggagccccttcatccagcggccgctgcataagaggaagggtgggcaggtgcgcttctccaacgagcagaccatcgagctggagaagaagttcgagacgcagaaatacctctccccgcccgagaggaagcgcctggccaagctgctgcagctcagcgagcgccaggtcaaaacgtggttccagaaccgcagagccaaatggaggcgactgaagcaggagaacccccaggccaccaaaaaggaggaggcggaaggcaccggcgatcacggcgaccctcggccggagggcagccccagccccgcgggggggggcgaggccgagccgcaggacagcccttcggccgcctcgcaggaggaccccgagtccgacgtctccgacgactccgaccaggaggtggacatcgagggcgacaaaggcttctacagcgccacacgctgacggcccgcgggcacggagccgagctcggcttgcgctgtcccgggactgcgggaaggaggattttatgacgggagaggaccttcaccattccgccgaaagacaaagaagcacgaacggactcgttctgtaataatctgagaaagaaaagatattcgttctgcaaacggtccgttttttttttggcagatctctgatttgattgtagggactgatcggtggtttgtatttactgtgtaagatctgtgtgtacgttgattggtgctctgaccgggacacagcgctgtgcccatctccggctgctggaacccccctcttccccagctcgtgtagtgggggagcactgagggcaggaccgtgcctttgtgtgtgcaaacgaatctgctttaaatggagtaatttaagtgtccttcgcaggcagagaagtgttttctgtgccatagagagggattggagcatcccgagagtgccttaccccacccaggacctgcagctgcatcccccggaaggatcccccctcaccgggcagaggctgtgggcacgttccgttttgctcttgatggagtgaaatgtccctcatcgcattttggaggattttgccccacaatctgtgtggttccatttgcagggaaaaaaaaacaaaaaccaaaaccaaacacagcaacaaaccaacccaggctatttttttccttgacaaatctgtcgtgctgtcccccagatttcccatttcagaaggaaatgaggggctgatagggcactgcgaggcgcagtgtggcagcgggcacccgtgcctggcgtgtccctctctgctcgtgtacatagcagtttgccttaaaagtctttgcggttttatacctcacattgttcatattttgtacatattggtttaaaagaaaaaaaaaaaggaatcaaaaactggtatttaatttctgatggatttcttcgaaataaaatgaaactctgcacca

//