2024-04-29 01:51:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_204193 1150 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus BARX homeobox 1 (BARX1), mRNA. ACCESSION NM_204193 VERSION NM_204193.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1150) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1150) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1150) AUTHORS Nakamura M, Nishida W, Mori S, Hiwada K, Hayashi K and Sobue K. TITLE Transcriptional activation of beta-tropomyosin mediated by serum response factor and a novel Barx homologue, Barx1b, in smooth muscle cells JOURNAL J Biol Chem 276 (21), 18313-18320 (2001) PUBMED 11359793 REFERENCE 4 (bases 1 to 1150) AUTHORS Barlow AJ, Bogardi JP, Ladher R and Francis-West PH. TITLE Expression of chick Barx-1 and its differential regulation by FGF-8 and BMP signaling in the maxillary primordia JOURNAL Dev Dyn 214 (4), 291-302 (1999) PUBMED 10213385 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000252.1. On Sep 23, 2021 this sequence version replaced NM_204193.1. ##Evidence-Data-START## Transcript exon combination :: AB044371.1, AF116460.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992432, SAMEA103992440 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-257 JAENSK010000252.1 3284076-3284332 258-546 JAENSK010000252.1 3285349-3285637 547-631 JAENSK010000252.1 3285729-3285813 632-1150 JAENSK010000252.1 3286039-3286557 FEATURES Location/Qualifiers source 1..1150 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="12" /map="12" gene 1..1150 /gene="BARX1" /gene_synonym="BARX1B" /note="BARX homeobox 1" /db_xref="CGNC:3820" /db_xref="GeneID:374017" exon 1..257 /gene="BARX1" /gene_synonym="BARX1B" /inference="alignment:Splign:2.1.0" CDS 53..796 /gene="BARX1" /gene_synonym="BARX1B" /note="homeobox protein BarH-like 1b; BarH-like homeobox 1; bar class homeoprotein Barx1b; homeodomain-containing transcription factor BarX-1" /codon_start=1 /product="homeobox protein BarH-like 1" /protein_id="NP_989524.2" /db_xref="CGNC:3820" /db_xref="GeneID:374017" /translation="
MQHPLELGAAHYFPAEAFPDHRSHRYRSFMIEEILTDPPDAKGAAPPGELLKFGVQALLSARPYHSHLAVLKAEPAAVFKFPLAPLGCSGLGSALLAAGSGLQGGSASPHLPLELHLRGKLEPGGPETGSKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPSSEQLSEQERARDAEKPPESLGSPAEVSQEE"
misc_feature 404..466 /gene="BARX1" /gene_synonym="BARX1B" /note="propagated from UniProtKB/Swiss-Prot (Q9DED6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(458..472,476..478,527..529,545..547,584..586, 590..595,602..607,611..619,623..628) /gene="BARX1" /gene_synonym="BARX1B" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 464..625 /gene="BARX1" /gene_synonym="BARX1B" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(464..466,473..475,593..595,602..607,614..616) /gene="BARX1" /gene_synonym="BARX1B" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 641..793 /gene="BARX1" /gene_synonym="BARX1B" /note="propagated from UniProtKB/Swiss-Prot (Q9DED6.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 258..546 /gene="BARX1" /gene_synonym="BARX1B" /inference="alignment:Splign:2.1.0" exon 547..631 /gene="BARX1" /gene_synonym="BARX1B" /inference="alignment:Splign:2.1.0" exon 632..1150 /gene="BARX1" /gene_synonym="BARX1B" /inference="alignment:Splign:2.1.0" ORIGIN
agggcccggcggccgggctcggctcggcacggcccgggcggcggcggcgaggatgcagcacccgctggagctgggggccgcgcactacttcccggccgaagcctttcccgaccaccgctcgcaccgctaccgcagtttcatgattgaggagatcctcaccgacccccccgacgccaaaggcgcggcgccgcccggggagctgctcaagttcggggtgcaggcgctgctgtcggcccggccctaccacagccacctcgccgttctgaaggcggagccggcggccgtcttcaagttcccgctggctcccctgggctgctcggggctgggctcggcgctgctggccgccggctcggggctgcagggcggctccgcctcgccccacctcccgctggagctgcacctccgcggcaagctggagccgggcggccccgagacgggcagcaaggccaagaagggccgccgcagccgcaccgtcttcacggagctgcagctcatggggctggagaagcgcttcgagaagcagaagtacctctcgacgcccgacagaatagacctggccgaatcgctggggctcagccagctccaggtgaaaacctggtaccagaacaggcgcatgaaatggaagaaaatagtgctgcaggggggcggcctggagtcccccaccaagcccaagggccgccccaagaagaactccatccccagcagcgagcagctctcggagcaggagcgcgcccgggacgccgagaaaccccccgagagcctgggctcgccggctgaggtcagccaggaggagtgagggcacggcccggccccaccgctgccgcccgggagcgcggggacccccagcgccgcgccgggccccggagcgcgttgccccgggcgggaggaaccccgcgcgcagcggcccgggcggtagaggacgggggcggagggcggtggggccgcggtcggagcactcggcgcacagctcggcccccggccctgagacccgcggtgcgcggcggccggggggcaccgggtccgccctcggcattgctcgctgcgtgaaaccctgtggtgcccccagttactcgaaaaactgcattttacgatcggttttattaatgcgaagatatttactttatttcaataaagtattttatggactatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]