LOCUS       NM_204137               1842 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus NK3 homeobox 2 (NKX3-2), mRNA.
ACCESSION   NM_204137
VERSION     NM_204137.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1842)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1842)
  AUTHORS   Faure S, Georges M, McKey J, Sagnol S and de Santa Barbara P.
  TITLE     Expression pattern of the homeotic gene Bapx1 during early chick
            gastrointestinal tract development
  JOURNAL   Gene Expr Patterns 13 (8), 287-292 (2013)
   PUBMED   23727297
  REMARK    GeneRIF: The spatio-temporal expression profile of Bapx1 in the
            chick gastrointestinal tract.
REFERENCE   3  (bases 1 to 1842)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1842)
  AUTHORS   Cairns DM, Liu R, Sen M, Canner JP, Schindeler A, Little DG and
            Zeng L.
  TITLE     Interplay of Nkx3.2, Sox9 and Pax3 regulates chondrogenic
            differentiation of muscle progenitor cells
  JOURNAL   PLoS One 7 (7), e39642 (2012)
   PUBMED   22768305
  REMARK    GeneRIF: the balance of Pax3, Nkx3.2 and Sox9 may act as a
            molecular switch during the chondrogenic differentiation of muscle
            progenitor cells, which may be important for fracture healing.
REFERENCE   5  (bases 1 to 1842)
  AUTHORS   Cairns DM, Sato ME, Lee PG, Lassar AB and Zeng L.
  TITLE     A gradient of Shh establishes mutually repressing somitic cell
            fates induced by Nkx3.2 and Pax3
  JOURNAL   Dev Biol 323 (2), 152-165 (2008)
   PUBMED   18796301
  REMARK    GeneRIF: Varying levels of Shh signaling act in a morphogen-like
            manner to elicit differing responses from somitic cells, Pax3 and
            Nkx3.2 set up mutually repressing cell fates that promote either
            dermomyotome/myotome or sclerotome differentiation, respectively.
REFERENCE   6  (bases 1 to 1842)
  AUTHORS   Provot S, Kempf H, Murtaugh LC, Chung UI, Kim DW, Chyung J,
            Kronenberg HM and Lassar AB.
  TITLE     Nkx3.2/Bapx1 acts as a negative regulator of chondrocyte maturation
  JOURNAL   Development 133 (4), 651-662 (2006)
   PUBMED   16421188
  REMARK    GeneRIF: Nkx3.2 represses expression of the chondrocyte maturation
            factor Runx2, and Runx2 mis-expression can rescue the
            Nkx3.2-induced blockade of chondrocyte maturation.
REFERENCE   7  (bases 1 to 1842)
  AUTHORS   Wilson J and Tucker AS.
  TITLE     Fgf and Bmp signals repress the expression of Bapx1 in the
            mandibular mesenchyme and control the position of the developing
            jaw joint
  JOURNAL   Dev Biol 266 (1), 138-150 (2004)
   PUBMED   14729484
  REMARK    GeneRIF: alteration of expression domain results in a new position
            of the jaw joint
REFERENCE   8  (bases 1 to 1842)
  AUTHORS   Nishida W, Nakamura M, Mori S, Takahashi M, Ohkawa Y, Tadokoro S,
            Yoshida K, Hiwada K, Hayashi K and Sobue K.
  TITLE     A triad of serum response factor and the GATA and NK families
            governs the transcription of smooth and cardiac muscle genes
  JOURNAL   J Biol Chem 277 (9), 7308-7317 (2002)
   PUBMED   11744740
REFERENCE   9  (bases 1 to 1842)
  AUTHORS   Rodriguez Esteban C, Capdevila J, Economides AN, Pascual J, Ortiz A
            and Izpisua Belmonte JC.
  TITLE     The novel Cer-like protein Caronte mediates the establishment of
            embryonic left-right asymmetry
  JOURNAL   Nature 401 (6750), 243-251 (1999)
   PUBMED   10499580
REFERENCE   10 (bases 1 to 1842)
  AUTHORS   Schneider A, Mijalski T, Schlange T, Dai W, Overbeek P, Arnold HH
            and Brand T.
  TITLE     The homeobox gene NKX3.2 is a target of left-right signalling and
            is expressed on opposite sides in chick and mouse embryos
  JOURNAL   Curr Biol 9 (16), 911-914 (1999)
   PUBMED   10469600
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB042507.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB042507.1, AF138905.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992432
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1842
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="4"
                     /map="4"
     gene            1..1842
                     /gene="NKX3-2"
                     /gene_synonym="BAPX1; NKX-3.2"
                     /note="NK3 homeobox 2"
                     /db_xref="CGNC:48963"
                     /db_xref="GeneID:373932"
     exon            1..465
                     /gene="NKX3-2"
                     /gene_synonym="BAPX1; NKX-3.2"
                     /inference="alignment:Splign:2.1.0"
     CDS             102..932
                     /gene="NKX3-2"
                     /gene_synonym="BAPX1; NKX-3.2"
                     /note="NK class homeoprotein Nkx-3.2; bagpipe homeobox
                     homolog 1"
                     /codon_start=1
                     /product="homeobox protein Nkx-3.2"
                     /protein_id="NP_989468.1"
                     /db_xref="CGNC:48963"
                     /db_xref="GeneID:373932"
                     /translation="

MAVRGGGGGGGTALTPFSIQAILNKKEERARGWRLCAARAEAPPPPAPRPPPAWDSDSALSEEPESERRSEEESAGGSARPPEAAGRGAAGGGGAALGGGGGRDRDRDGARSDSEASAAASGRGPAEEEEAAGGRLLAAEEEAAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLAAAPAAKKVAVKVLVRDDQRQYQPGEVLRPPSLLALQPSYYYPYYCLPGWALSCAAAAGTQ"

     misc_feature    552..722
                     /gene="NKX3-2"
                     /gene_synonym="BAPX1; NKX-3.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            466..1809
                     /gene="NKX3-2"
                     /gene_synonym="BAPX1; NKX-3.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cggcggcggcggcggcggcgcggccggccggagcgggcgatgcgggcgccgagctgaagttgcggcgcttgtcgctgctctccgcccggggccgccgggccatggccgtccgcggcggcggcggcggcggcggcaccgccctgacgcctttctccatccaggccatcctcaacaagaaggaggagcgcgcccgcggctggcggctgtgcgctgcccgcgccgaggccccgccgccgcccgccccgcgcccgccgcccgcctgggactcggactcggcgctgagcgaggagcccgagagcgagcggcgctccgaggaggagagcgccgggggcagcgcccgcccccccgaggcggcgggcaggggggcggccggcggcggaggcgcggccctcggaggcggcggcggacgggaccgggaccgggacggagcgcgcagcgacagcgaagcgtcggccgccgcctcaggtcgcggcccggccgaggaggaggaggcggcgggcgggaggctgctggcggccgaggaggaggcggcggcgccgaagccgcgcaagaagcgctcccgcgccgccttctcccacgcgcaggtgttcgagctggagcggcgcttcaaccaccagcgctacctgtcggggcccgagcgcgccgacctggccgcctccctcaagctgaccgagacgcaggtgaagatctggttccagaaccgccgctacaaaaccaagcggcggcagatggcagccgacctgctggccgccgcccccgccgccaagaaggtggccgtcaaggtgctggtgcgcgacgaccagagacagtaccagcccggcgaggtgctgcggccgccctcgctgctcgccctgcagccctcctactactacccctactactgcctgcccggctgggccctgtcctgcgccgcggccgccggcacgcagtgagcgccccgacggcaccgccccgacggcagcgccgcggcgccccggacagtatttattgctattttattgttatttttattattaatattattcggacggtcgctcggcctctccctatcgccccggcggccgaggactcgcggccgggcaccgcctctccacgggatccacgctgcggtgcggcggccgcggaccgtctgttggtttgtctgctccgtcccgcgtcggatcggcggagactgacgtgggagacgcaaagagagaggggggaaagaaaacacccaaagcgccgcggaaccgagcgcagctccgaggagacgagaacggatcccggggggctctgagagcgccgtgagcggggctgaatgtacggagcctctcccacccccggccgtgtcagcccactgcgaaggataaccgtgtcccgtagggtgagacccgccccagcgctccaggcttcttcttcttcttcttctgttttatttcctgagatctttccgtgttcggggagggaggattctggatttttcgcactttccggttgtattaaagttgttgttatttttatattcaatgtgaatatttctaggcaggctttaaaaaaaaaacagaaaagaaaactcgatgtaacgggaaatgttaatgccatcagtgccttttgtgcagtcgttctgcagccctcctcacaagtgtaattacggtctctttccctcgaggtaacccatcgctttgtttctttctttctttctttttctccctttaatggcactgtgcactcaacgacgctatcgactccaaatggattgtgaatgtgtgtaagcagcccgctgtactttttttttttttttttttttaatttataaacgttacgttcccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa

//