LOCUS       NM_001398146            1581 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus NK2 homeobox 2 (NKX2-2), mRNA.
ACCESSION   NM_001398146 XM_015283379
VERSION     NM_001398146.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1581)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1581)
  AUTHORS   Mansour AA, Khazanov-Zisman S, Netser Y, Klar A and Ben-Arie N.
  TITLE     Nato3 plays an integral role in dorsoventral patterning of the
            spinal cord by segregating floor plate/p3 fates via Nkx2.2
            suppression and Foxa2 maintenance
  JOURNAL   Development 141 (3), 574-584 (2014)
   PUBMED   24401371
  REMARK    GeneRIF: Nato3 induces ectopic Foxa2-positive cells and indirectly
            downregulates Nkx2.2 expression.
REFERENCE   3  (bases 1 to 1581)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1581)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr Biol 12 (22), 1965-1969 (2002)
   PUBMED   12445392
REFERENCE   5  (bases 1 to 1581)
  AUTHORS   Qiu M, Shimamura K, Sussel L, Chen S and Rubenstein JL.
  TITLE     Control of anteroposterior and dorsoventral domains of Nkx-6.1 gene
            expression relative to other Nkx genes during vertebrate CNS
            development
  JOURNAL   Mech Dev 72 (1-2), 77-88 (1998)
   PUBMED   9533954
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000060.1, AF110994.1 and BU218415.1.
            
            On Dec 9, 2021 this sequence version replaced XM_015283379.3.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13267655.251210.1,
                                           SRR13267659.65364.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992393, SAMEA103992482
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-243               JAENSK010000060.1  1078710-1078952
            244-820             JAENSK010000060.1  1083543-1084119
            821-976             AF110994.1         2-157
            977-979             JAENSK010000060.1  1084409-1084411
            980-1474            BU218415.1         110-604
            1475-1563           JAENSK010000060.1  1084907-1084995
            1564-1581           AF110994.1         742-759
FEATURES             Location/Qualifiers
     source          1..1581
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="3"
                     /map="3"
     gene            1..1581
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /note="NK2 homeobox 2"
                     /db_xref="CGNC:25123"
                     /db_xref="GeneID:428549"
     exon            1..243
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /inference="alignment:Splign:2.1.0"
     exon            244..922
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    349..351
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /note="upstream in-frame stop codon"
     CDS             664..1482
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /note="NK2 transcription factor related, locus 2"
                     /codon_start=1
                     /product="homeobox protein Nkx-2.2"
                     /protein_id="NP_001385075.1"
                     /db_xref="CGNC:25123"
                     /db_xref="GeneID:428549"
                     /translation="

MSLTNTKTGFSVKDILDLPDTNDEDGSAAEGGEEESEAPEPPKKAAVLGQTPLDAVQTLPLKPPFYDNSDNPYTRWLASAEGIQYSLHGLAAGAGGPEAGSKSPEPSADESPDNEKEAAGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHTLKAQDLAAATFQTGIPFSAYSAQSLQHMQYNAQYSAAGSPQYPTAHHLVQAQQWTW"

     misc_feature    1045..1215
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            923..1568
                     /gene="NKX2-2"
                     /gene_synonym="NKX-2.2; Nkx2.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggccggcttaaaagagccatccaggaaccggcgtgtttgcgcttataaccaatttattaccgccgaacatatggccagtatttcgcctggcgtcacacgccggggaggaaagcaaacagagcgggcgatgtaaagccggaggaaggagcggccgccccgcacacgccggagacaatgcgagaggcgcggagccgccgccgccgccgcgctcaacccccgcccgcttagcacggcccggcccaggttcatgtgcggggaccagccttatatggactgttcgctccggcaatggctcgtttctttcacgcggcaagcgcggctccgggctgtgtcagccccgtccagaagtgatctcttcgcctgctttttttctcctttttttctgtaattctcggctcgccgttccccttcccctggagttacaaactgtttccgaagcggctgccgccccgctccccgagtcccccccgggcagaaggagcccgcggagatccggggctccgccggggctccgttcgtccctcggcacgaagcgctccgctcctttttctccacgtttttccccgccgcccgcgccctcccctcgcgctgtcgccgctgtcgctccgggtgacagctcggcgagctgctcctccaactttccggccccgatttccccggaccatgtctctgaccaacacaaagacgggtttttccgtcaaggacatcctggacctccccgacaccaacgacgaggacggctccgccgcggaagggggagaggaggagagcgaagcgccggagcctcccaagaaagcggcggtgttgggccaaacccccttggacgctgttcagacgctgcctttgaagccccctttctatgataatagcgataatccctacacgcgctggctggcgagcgccgagggcatccagtactccctgcacggactggcggccggagcaggcggcccggaggccggctccaagtccccggagccgtcggccgacgaatcgcccgacaacgagaaggaggcggcgggcggaggggacgcggggaagaagaggaagaggagggtgctcttctccaaggcgcagacctacgagctggagcggcggttccggcagcagcggtacctgtcggcgccggagagggagcacctggccagcctgatccgcctgacgcccacccaggtgaagatctggttccagaaccaccgctacaagatgaagcgggcccgggccgagaaaggtatggaagtgactcctctcccctccccgcggcgggtggccgtgccggtcctggtgcgggacggcaagccctgccacacgctcaaagctcaggacttggcggccgccaccttccagacgggcatccccttctccgcctatagcgcccagtccctccagcatatgcaatacaacgcccagtacagcgcggccggcagcccccagtaccccacagcgcaccacttggtacaggcgcagcaatggacttggtgagcgcggggtgagcgcacgcacacggccctcgcgcgcacccacacacgcagagaggaggaaaaaataacgataaagagacacgaaaaaaaaaaaaaaaaa

//