ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-10 07:08:04, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001397354 1157 bp mRNA linear VRT 01-MAY-2025 DEFINITION Gallus gallus HOP homeobox (HOPX), transcript variant 5, mRNA. ACCESSION NM_001397354 VERSION NM_001397354.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1157) AUTHORS Tang,H., Finn,R.D. and Thomas,P.D. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1157) AUTHORS Kovarova,D., Plachy,J., Kosla,J., Trejbalova,K., Cermak,V. and Hejnar,J. TITLE Downregulation of HOPX controls metastatic behavior in sarcoma cells and identifies genes associated with metastasis JOURNAL Mol Cancer Res 11 (10), 1235-1247 (2013) PUBMED 23938949 REMARK GeneRIF: Data demonstrate that HOPX is a metastasis-associated gene and that its knockdown decreases the metastatic activity of v-src-transformed cells through altered gene expression patterns. REFERENCE 3 (bases 1 to 1157) AUTHORS Burge,S., Kelly,E., Lonsdale,D., Mutowo-Muellenet,P., McAnulla,C., Mitchell,A., Sangrador-Vegas,A., Yong,S.Y., Mulder,N. and Hunter,S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1157) AUTHORS Vasiliev,O., Rhodes,S.J. and Beebe,D.C. TITLE Identification and expression of Hop, an atypical homeobox gene expressed late in lens fiber cell terminal differentiation JOURNAL Mol Vis 13, 114-124 (2007) PUBMED 17277742 REMARK GeneRIF: Expression pattern of Hop provides first evidence that new transcription is initiated in lens fiber cells after they detach from the capsule. Hop may be first of class of genes with this pattern of expression. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1157) AUTHORS Adu,J., Leong,F.T., Smith,N.R., Leek,J.P., Markham,A.F., Robinson,P.A. and Mighell,A.J. TITLE Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain protein, during mouse development JOURNAL Mech Dev 119 Suppl 1, S43-S47 (2002) PUBMED 14516659 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000074.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR12888486.102165.1, SRR12888488.97931.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN02738218, SAMN02738221 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-120 JAENSK010000074.1 1816107-1816226 c 121-216 JAENSK010000074.1 1815872-1815967 c 217-298 JAENSK010000074.1 1812777-1812858 c 299-467 JAENSK010000074.1 1810280-1810448 c 468-1157 JAENSK010000074.1 1807464-1808153 c FEATURES Location/Qualifiers source 1..1157 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="4" /map="4" gene 1..1157 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /note="HOP homeobox" /db_xref="CGNC:8667" /db_xref="GeneID:395241" exon 1..120 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /inference="alignment:Splign:2.1.0" exon 121..216 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /inference="alignment:Splign:2.1.0" exon 217..298 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /inference="alignment:Splign:2.1.0" exon 299..467 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /inference="alignment:Splign:2.1.0" misc_feature 303..305 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /note="upstream in-frame stop codon" CDS 324..545 /gene="HOPX" /gene_synonym="HOD; HOP; OB1" /note="odd homeobox 1 protein; odd homeobox protein 1" /codon_start=1 /product="homeodomain-only protein" /protein_id="NP_001384283.1" /db_xref="CGNC:8667" /db_xref="GeneID:395241" /translation="
MATEKSVTPTEEQLEILEYNFCKVNKHPDPTTLCLIAAETGLSEEQTLKWFKQRLAEWRKSEGLPSECGSVRD"
misc_feature 336..509
/gene="HOPX"
/gene_synonym="HOD; HOP; OB1"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:238039"
misc_feature order(336..344,348..350,402..404,420..422,459..461,
465..470,477..482,486..494,498..503)
/gene="HOPX"
/gene_synonym="HOD; HOP; OB1"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(336..338,345..347,468..470,477..482,489..491)
/gene="HOPX"
/gene_synonym="HOD; HOP; OB1"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
exon 468..1157
/gene="HOPX"
/gene_synonym="HOD; HOP; OB1"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcactttttcccctgaaggaaggaagactccttgatgggcctggaggcagtctgcatgctgtttctttaatctgactctcctgtcaaagggactgcatctggggccaggatattttccaggactcccagcagctctgataccatttcagtggcacgtctcagcctgaaatacttcactgccagcgctccctgtgcaagtctgggctggattcagagaaaaataagctagcggtggtgcctttcagcagttgagcagaacagttgtgattctccatcttcctgccaggcttaaagaaagtgcctgaccccaccatccaggagaaatggccacggagaagtcagtgactcctactgaggagcagctagagatcctggagtacaatttttgcaaggtgaacaagcatcctgatcccaccacgctgtgcctcattgcagctgagaccgggctttctgaagagcagaccctgaaatggttcaagcagcgcctggcagagtggaggaagtctgaagggctgccctcagaatgtgggtctgtgagggactagaggatgctgctcctggccccatccatgctgtaaacgatggtgaagatcttcagagtgggtttacttggggttctcctgtcacaaaaggtttcaagatacaaagcaataccctgatatttaacataatttttatttatagaagattatatatatataatatgtatgtatatgtgtatacagctcctgatggctgcataacttgtctagcaattcccattaatagcagctgcacaggccaggaaatctcatgcccttgtcctgggctcatggaaaagctgccaagaaaggatcaagcacaggagggaggaatagagatttcttttccctatgatcccaagaggcaaagcatgcatgctagctttagtatatagagcatccagaaaggagggcaattggaaaacttgatgtcttgatcttgtgatgtcttggttagtttaaggtgcccaagccagctctggatattgacaagctaagagcctacatcattaacagactgagccaagatcctttgaatgtatgtctcacatttctgttaaagatcaccgaagggagagaactggtcttttctttgtccaaagtgtgaataaaaaccaaagatttttggtgagagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]